Recombinant Mouse Urokinase Protein (FITC)
Beta LifeScience
SKU/CAT #: BLA-10158P
Recombinant Mouse Urokinase Protein (FITC)
Beta LifeScience
SKU/CAT #: BLA-10158P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Synonym | ATF ATF uPA BDPLT5 Plasminogen activator Plasminogen activator urinary Plasminogen activator urokinase PLAU QPD u PA U plasminogen activator u-PA U-plasminogen activator uPA URK UROK_HUMAN Urokinase plasminogen activator Urokinase type plasminogen activator Urokinase type plasminogen activator precursor Urokinase-type plasminogen activator chain B |
Description | Recombinant Mouse Urokinase Protein (FITC) was expressed in Insect cells. It is a Full length protein |
Source | Insect cells |
AA Sequence | MKVWLASLFLCALVVKNSEGGSVLGAPDESNCGCQNGGVCVSYKYFSRIR RCSCPRKFQGEHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAV LQKPYNAHRPDAISLGLGKHNYCRNPDNQKRPWCYVQIGLRQFVQECMVH DCSLSKKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQK |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |