Recombinant Mouse Uteroglobin Protein
Beta LifeScience
SKU/CAT #: BLA-1177P
Recombinant Mouse Uteroglobin Protein
Beta LifeScience
SKU/CAT #: BLA-1177P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q06318 |
Synonym | Blastokinin CC10 CC16 CCPBP CCSP Clara cell phospholipid binding protein Clara cell phospholipid-binding protein Clara cell specific 10 kD protein Clara cells 10 kDa secretory protein OTTHUMP00000236107 SCGB1A1 Secretoglobin family 1A member 1 Secretoglobin, family 1A, member 1 (uteroglobin) UG UGB UP-1 UP1 Urinary protein 1 Urine protein 1 UTER_HUMAN Uteroglobin |
Description | Recombinant Mouse Uteroglobin Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQ ETRINIMKLTEKILTSPLCKQDLRF |
Molecular Weight | 17 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of >200 IU/m. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2. |
Subcellular Location | Secreted. |
Protein Families | Secretoglobin family |
Database References | |
Tissue Specificity | Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways). |
Gene Functions References
- the present results demonstrate that rCC16 has therapeutic effects on COPD by downregulating proinflammatory factors via the NFkappaB pathway. PMID: 29956762
- This study extends the function of the Scgb1a1-expressing epithelial cell population as a major mediator of the antiviral response. It PMID: 29593031
- Chronic P. aeruginosa inflammation resulted in chronic bronchitis and emphysematous changes in CCSP-deficient mice. PMID: 27703342
- CC16 protects lungs from cigarette smoke (CS)-induced injury by reducing lung NF-kappaB activation. CS-induced airway CC16 deficiency increases CS-induced pulmonary inflammation and injury and likely contributes to the pathogenesis of COPD. PMID: 25700379
- Depletion of bone marrow CCSP-expressing cells delays airway regeneration. PMID: 25409745
- Serum CC-16 is associated with disease progression in chronic obstructive pulmonary disease (COPD). However, the absence of CC-16 does not appear to modify the risk of cigarette-related COPD in mice. PMID: 24245748
- These findings indicate that CCSP has a regulatory role in obliterative bronchiolitis. PMID: 23997179
- the role of clara cells and clara cell secretory protein in lung radiation injury exacerbated by viral infection PMID: 23621375
- AAV2/9-CC10 vector virus guaranteed sufficient CC10 expression and had an anti-inflammatory effect in asthmatic mice. PMID: 23013277
- Claudin-3 and Clara cell 10 kDa protein were identified as possible markers of early tobacco smoke-induced epithelial injury along alveolar ducts. PMID: 22659244
- Scgb1a1-expressing cells, most likely Clara cells, are a major cell type that gives rise to alveolar type I and II cells during the regeneration of alveolar epithelia in response to severe pulmonary damage in mice. PMID: 23119022
- These results indicate that CC10 gene transfer may inhibit airway inflammation through suppressing the activation of NF-kappaB. PMID: 22558282
- Clara cell secretory protein expression is elevtaed in lungs after long-term n-hexane inhalation exposure. PMID: 20853679
- CCSP promoter has a role in alveolar development PMID: 20693404
- The expression of CC10 is downregulated in sinonasal mucosa in bacterial chronic rhinosinusitis. PMID: 19119605
- Expression of SCGB1A1 mRNA was not decreased in vivo in the absence of C/EBPs. PMID: 21224212
- The differential expression of mRNA by both airway level and lung region was determined for Clara cell secretory protein. PMID: 20852037
- Lack of uteroglobin in mice enhances colonization of B16F10 melanoma cells in the lungs. PMID: 20118237
- macrophages from Clara cell-depleted and CCSP(-/-) mice displayed increased Toll-like receptor 4 surface expression PMID: 19423773
- Uteroglobin promoter-targeted c-MYC expression in transgenic mice cause hyperplasia of Clara cells and malignant transformation of T-lymphoblasts and tubular epithelial cells PMID: 11817538
- Data show that Clara cell secretory protein (CCSP) is required for the appearance of secretory granules and that functional changes to Clara cells that result from CCSP deficiency lead to alterations in the composition of epithelial lining fluid. PMID: 12151308
- demonstrate synergistic transactivation by C/EBPalpha and Nkx2.1 in the regulation of the CCSP gene PMID: 12161423
- An immunohistochemical analysis was made of the expression of this protein in a transgenic model of mouse lung carcinogenesis. PMID: 12699910
- Restoration of CCSP in the airways of CCSP-deficient mice abrogates the increase in viral persistence, lung inflammation, and airway hyperreactivity induced by respiratory syncytial virus infection. PMID: 12847279
- Multiple mechanisms for repression of the Clara cell secretory protein gene during hyperoxia. PMID: 14500549
- Data show that 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone exposure of Clara cell 10-kDa protein knock-out mice causes a significantly higher incidence of airway epithelial hyperplasia and lung adenomas compared with wild type littermates. PMID: 15148323
- plays a direct role in the regulation of T-cell-mediated inflammatory responses. PMID: 15356574
- We propose that mechanical activation of the cPLA2 pathway contributes to acute high PIP-induced lung injury and that CCSP may reduce this injury through inhibition of the cPLA2 pathway and reduction of proinflammatory products produced by this pathway. PMID: 15608088
- Uteroglobin suppresses SCCA gene expression associated with airway inflammation in asthma PMID: 15677460
- uteroglobin plays important roles in maintaining homeostasis in organs that are vulnerable to inadvertent stimulation of FP-mediated inflammatory response by inhibiting the prostaglandin F2alpha receptor PMID: 16061484
- A critical role for uteroglobin in preventing the development of pulmonary fibrosis. PMID: 16872605
- These results suggest that both long- and short-range paracrine signaling between nonciliated secretory cells and cells of the immune system and epithelium impact modification of cell type-specific proteins. PMID: 17384087
- Treatment of lung neoplasms with bexarotene resulted in decreased mRNA expression. PMID: 17849452
- Clara cells accumulated Clara cell secretory protein (CCSP) in Munc13-2-deficient mice. PMID: 18258655
- preferentially expressed in mouse model of allergen-induced airway inflammation and remodeling PMID: 19322781