Recombinant Mouse Wnt8b Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-1204P
Recombinant Mouse Wnt8b Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-1204P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9WUD6 |
Synonym | Protein Wnt-8b Wingless related MMTV integration site 8b Wingless type MMTV integration site family, member 8B Wnt 8b Wnt8 b Wnt8b WNT8B_HUMAN |
Description | Recombinant Mouse Wnt8b Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQL SSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQL GGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAV KGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQ GAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGREC LRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCE QCRRRVTKYFCSRAERPPRGAAHKPGKNS |
Molecular Weight | 56 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. |
Protein Families | Wnt family |
Database References | STRING: 10090.ENSMUSP00000042867 UniGene: Mm.88365 |