Recombinant Pig Erythropoietin (EPO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10803P
Greater than 90% as determined by SDS-PAGE.
Recombinant Pig Erythropoietin (EPO) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10803P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Pig Erythropoietin (EPO) Protein (His) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P49157 |
Target Symbol | EPO |
Synonyms | EPOErythropoietin |
Species | Sus scrofa (Pig) |
Expression System | Mammalian cell |
Tag | N-6His |
Target Protein Sequence | APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR |
Expression Range | 27-194aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 22.6kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3. |
Subcellular Location | Secreted. |
Protein Families | EPO/TPO family |
Database References | |
Tissue Specificity | Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. |
Gene Functions References
- EPO might play a role as a survival factor or as a mitogen in developing cartilage tissue. PMID: 19908127
- Pyruvate-fortified cardioplegia evokes myocardial erythropoietin signaling in swine undergoing cardiopulmonary bypass. PMID: 19767525