Recombinant Pig Interleukin-4 Receptor Subunit Alpha (IL4R) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11125P

Greater than 85% as determined by SDS-PAGE.
Recombinant Pig Interleukin-4 Receptor Subunit Alpha (IL4R) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11125P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Pig Interleukin-4 Receptor Subunit Alpha (IL4R) Protein (His) is produced by our Yeast expression system. This is a extracellular protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q863Z5 |
Target Symbol | IL4R |
Synonyms | IL4RInterleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD antigen CD124 |
Species | Sus scrofa (Pig) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR |
Expression Range | 33-240aa |
Protein Length | Extracellular Domain |
Mol. Weight | 26.2 |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Protein Families | Type I cytokine receptor family, Type 4 subfamily |
Database References |