Recombinant Rabbit GM-CSF Protein
Beta LifeScience
SKU/CAT #: BLA-10758P
Recombinant Rabbit GM-CSF Protein
Beta LifeScience
SKU/CAT #: BLA-10758P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rabbit |
Accession | B7NZK6 |
Synonym | Colony stimulating factor Colony Stimulating Factor 2 Colony stimulating factor 2 (granulocyte-macrophage) Colony-stimulating factor CSF CSF 2 CSF2 CSF2_HUMAN GM-CSF GMCSF Granulocyte Macrophage Colony Stimulating Factor Granulocyte-macrophage colony-stimulating factor MGC131935 MGC138897 MGI1GM Molgramostin Pluripoietin-a Sargramostim |
Description | Recombinant Rabbit GM-CSF Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | APTHQPNTVSQPLKHVDAIKEARIILSRSNDSATVLGEMVEVVSEMFDPQ KPTCLQTRLELYKQGLRGSLERLSSTLTLMASHYKQNCPPTPETSCETEF ITFKSFKENLKCFLFVIPFNCWEPVQK |
Molecular Weight | 14 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C. Avoid freeze / thaw cycle. |