Recombinant rabbit TPA Tissue Plasminogen Activator Protein
Beta LifeScience
SKU/CAT #: BLA-10263P
Recombinant rabbit TPA Tissue Plasminogen Activator Protein
Beta LifeScience
SKU/CAT #: BLA-10263P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rabbit |
Synonym | Alteplase DKFZp686I03148 Plasminogen activator tissue Plasminogen activator tissue type PLAT Reteplase t PA T Plasminogen Activator t-PA T-plasminogen activator Tissue plasminogen activator (t PA) Tissue type plasminogen activator Tissue-type plasminogen activator chain B tPA TPA_HUMAN TPA1 |
Description | Recombinant rabbit TPA Tissue Plasminogen Activator Protein was expressed in Insect cells. It is a Full length protein |
Source | Insect cells |
AA Sequence | GARSFRVTCVDQQTQLTYQRRESWLRPGLRGNRVEYCRCSSGGPRCHSVP VQSCSEPRCLNGGTCSQALYFSDFVCQCPEGFVGKRCEVDTRARCYEDRG IGYRGTWSTTESGAQCVNWNSSWLALKPYSGRKPNALRLGLGNHNYCRNP DRDTKPWCYVFRAGTYSPEFCSTPACSKEKNGNCYLGKGQAYRGTHSLTT |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Activity: 2,105,900 IU/mg>95 percent active. Fully complexable with Human PAI-1. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |