Recombinant Rabbit VEGFA Protein
Beta LifeScience
SKU/CAT #: BLA-2243P
Recombinant Rabbit VEGFA Protein
Beta LifeScience
SKU/CAT #: BLA-2243P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rabbit |
Synonym | Folliculostellate cell-derived growth factor Glioma-derived endothelial cell mitogen MGC70609 MVCD1 vascular endothelial growth factor Vascular endothelial growth factor A vascular endothelial growth factor A121 vascular endothelial growth factor A165 Vascular permeability factor Vegf VEGF A VEGF-A VEGF120 Vegfa VEGFA_HUMAN VPF |
Description | Recombinant Rabbit VEGFA Protein was expressed in Yeast. It is a Protein fragment |
Source | Yeast |
AA Sequence | APMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPS CVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR |
Molecular Weight | 14 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |