Recombinant Rat Apolipoprotein C-Iii (APOC3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10752P

Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Apolipoprotein C-Iii (APOC3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10752P
Collections: Cytokines, High-quality recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Apolipoprotein C-Iii (APOC3) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P06759 |
Target Symbol | APOC3 |
Synonyms | Apoc3; Apolipoprotein C-III; Apo-CIII; ApoC-III; Apolipoprotein C3 |
Species | Rattus norvegicus (Rat) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP |
Expression Range | 21-101aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 11.0kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners. |
Subcellular Location | Secreted. |
Protein Families | Apolipoprotein C3 family |
Database References | STRING: 10116.ENSRNOP00000067045 UniGene: Rn.129547 |
Tissue Specificity | Synthesized predominantly in liver and to a lesser degree in intestine. |