Recombinant Rat Beta-Nerve Growth Factor (NGF) Protein (His)

Name: Recombinant Rat Beta-Nerve Growth Factor (NGF) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10848P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Beta-Nerve Growth Factor (NGF) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P25427
Target Symbol	NGF
Synonyms	Ngf; Ngfb; Beta-nerve growth factor; Beta-NGF
Species	Rattus norvegicus (Rat)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG
Expression Range	122-241aa
Protein Length	Full Length of Mature Protein
Mol. Weight	15.4kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival. The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form.
Subcellular Location	Secreted. Endosome lumen.
Protein Families	NGF-beta family
Database References	KEGG: rno:310738 STRING: 10116.ENSRNOP00000022200 UniGene: Rn.22168
Tissue Specificity	Detected in the granule and pyramidal cell layer in the hippocampus.

Gene Functions References

proinflammatory cytokines suppressed the TGFbetamediated expression of NGF in PDLderived fibroblasts through the inactivation of TGFbetainduced Smad2/3 and p38 MAPK signaling. PMID: 29901090
Impairments in the extracellular maturation of proNGF are sufficient to cause a somatodendritic retrograde degeneration o fdegeneration of basal forebrain cholinergic neurons. PMID: 29609077
McGill APP transgenic rats exhibit differential dysregulation in NGF and BDNF neurotrophins. At early stages, intraneuronal Abeta leads to significant reductions in BDNF mRNA expression, which correlate with learning and memory deficits. At later stages, deficits in the NGF metabolic pathway could explain the paradoxical upregulation of proNGF in the absence of changes in NGF mRNA. PMID: 28865749
p75NTR is sufficient to mediate the modulation of myogenic cells differentiation by NGF in terms of structural, metabolic and functional changes. PMID: 29202822
NGF protects GECs against IND-induced injury. Mitochondria are major targets of both INDO-induced injury and NGF afforded protection of GECs. TrkA expression in the mitochondria of GECs indicates that the protection afforded by NGF is partly mediated by its direct action on mitochondria. NGF prevents MMP depolarization and increases expression of IGF-1 protein in GECs. PMID: 28843696
The results suggest that NGF is a prominent hyperalgesic mediator in the trigeminal system and plays a role in trigeminal neuropathic pain PMID: 27392124
Early and late behavioral changes in sciatic nerve injury may be modulated by nerve growth factor and substance P in rats PMID: 28685530
A higher level of nerve growth factor in the early days post-transvaginal mesh implantation is associated with a shorter voiding interval and a smaller bladder capacity, which represents abnormal lower urinary tract symptoms following transvaginal mesh implantation. PMID: 27762470
Findings might aid in identifying effective treatment windows for nerve growth factor (NGF)-based strategies to counteract retinal and/or optic-nerve degeneration. PMID: 28067793
The aim of our study was to investigate the influence of two mild stressors, acute and chronic exposure to forced swim (FS) or high-light open field (HL-OF), on neurons containing NGF. PMID: 27978417
This work sheds light on the role of miR-132 in bladder overactivity, bladder hypertrophy, NGF signaling and expression of inflammatory mediators. Findings demonstrate that aberrant expression of NGF and miR-132 is involved in voiding dysfunctions. PMID: 27789288
Data indicate the effects of vitamin B12 and omega-3 fatty acid supplementation across three consecutive generations on brain neurotrophins like brain derived neurotrophic factor (BDNF); nerve growth factor (NGF) and cognitive performance in the third generation male offspring. PMID: 27569259
This study demonstrated that Age-dependent changes in the density of NGF-ir neurons in stressed rats are probably caused by ageing processes and they may point to dysregulation of excitatory control exerted by the amygdala. PMID: 26724365
Data indicate that nerve growth factor precursors and nerve growth factor (ProNGF and NGF) and the downstream effector proteins play an important role in the growth, differentiation, and apoptosis of oligodendrocyte (OLG). PMID: 26681653
NGF in the facet joint contributes to the development of injury-induced joint pain. Localized blocking of NGF signaling in the joint may provide potential treatment for joint pain. PMID: 26521746
This study deminstrated that elevated NGF after peripheral nerve injury induces neurite sprouting and the formation of synapse-like structures within the contralateral DRG, leading to the development of chronic mirror-image pain. PMID: 26121254
Results suggest the induction of NGF represents an adaptive response against immune-mediated neuroinflammation in the dorsal root ganglia and spinal cord that likely contributes to the experimental autoimmune encephalomyelitis attenuation PMID: 25801841
elevation of plasma norepinephrine in neonatal colonic inflammation induces NGF expression in the gastric fundus. PMID: 26608656
NGF acts directly on photoreceptors survival and prevents photoreceptor degeneration. PMID: 25897972
Identify nerve growth factor as a binding partner for MOG and demonstrate that this interaction is capable of sequestering NGF from TrkA-expressing neurons to modulate axon growth and survival. PMID: 26347141
Let-7 microRNAs regulate peripheral nerve regeneration by targeting nerve growth factor. PMID: 25394845
Ginger extract has a synaptogenic effect via NGF-induced ERK/CREB activation, resulting in memory enhancement. PMID: 25049196
Chronic heart failure impairs the expression of nerve growth factor in the sympathetic and sensory nerves. PMID: 24913185
Vibration significantly increases total-NGF mRNA in interverterbal discs. Protein expression of BDNF increases by nearly 10-fold, especially in the inner annulus fibrosus and nucleus pulposus. PMID: 24921856
NGF exhibits anti-oxidative and hepatoprotective effects and is suggested to be therapeutically applicable in treating cholestatic liver diseases. PMID: 25397406
Activation of microtubule dynamics increases neuronal growth via the NGF- and Galpha s-mediated signaling pathways. PMID: 25691569
NGF was increased 12, 24, and 48 hours in hippocampus after sepsis induction PMID: 24978930
Findings revealed that NGF may play a pivotal role of anti-apoptosis in spinal cord neurons through retrograde transport of NF-kappaB in Schwann cells following sciatic nerve injury in rats PMID: 24620979
Maternal separation decreased NGF levels in the hippocampus which was reversed with methamphetamine. PMID: 24407463
the level of NGF expression did not display a meaningful change throughout the immobilization period PMID: 24154957
Spinal nerve afferents are important in sustaining and up-regulating the expression of NGF in the sensory neurons innervating the heart in acute myocardial infarction. PMID: 24508054
NGF played an important role in the activation of Akt and subsequent up-regulation of BDNF in the sensory neurons in visceral inflammation such as cystitis. PMID: 24303055
The temporal mismatch in behaviour, skin [NGF] and phenotypic changes in sensory nerve fibres indicate that increased [NGF] does not cause hyperalgesia after partial mental nerve injury. PMID: 24380503
Using gene expression as a functional read-out, our data demonstrate that the relative availability of NGF and proNGF in vivo might modulate the biological outcome of these ligands. PMID: 24713110
The synergistic effects of grafting both NGF and GRGD ligands to PCL-CS scaffolds on the growth and differentiation of PC12 cells provide a new biomaterial for neural tissue engineering. PMID: 23468336
Denervation causes age-dependent increases in NGF in the VP, which is a potential mechanism by which the autonomic nervous system may regulate prostate growth and lead to BPH/LUTS PMID: 23872662
proBDNF accumulated in the hippocampus of aged rats. PMID: 23255148
The effects of acute and chronic administration of branched-chain amino acids on protein levels and mRNA expression of nerve growth factor, was investigated. PMID: 23559405
Suggest that nerve growth factor, which is elevated in the failing human heart, causes hypertrophy of neurons in cardiac ganglia. PMID: 23959444
Hyperosmolarity induces apoptosis of pHCECs by activating JNK signaling. PMID: 24327613
Environmental enrichment improves memory and increases nerve growth factor (NGF) concentration in the dentate gyrus. PMID: 23460346
NGF contributes to the repair of nerve tissue and improves pain-related behavior after inferior alveolar nerve injury. PMID: 23190308
Long-term casting induced heat hyperalgesia, and up-regulation and phenotypic change of NGF in dorsal root ganglia PMID: 23234417
Data indicate that nerve growth factor (NGF) mRNA levels changed significantly during Leydig-cell regeneration in vivo. PMID: 23743199
Upregulation of NGF in the amygdala promotes behavior of opioid reward and increases sensitivity to subsequent opioids. PMID: 22871918
This study suggests that application of hADSCs with NGF-hydrogel on the CN might be a promising treatment for postprostatectomy ED. PMID: 22834730
NGF increased expression of ASIC3 in DRG neurons. PMID: 22744968
[REVIEW] Neuropathies and clinical presentations result from disruption of NGF signalling in hereditary sensory autonomic neuropathies (HSAN) type IV and HSAN type V. PMID: 23157347
NGF gene expression is elevated during the whole course of cerebral concussion, especially in the early phase. PMID: 12857442
There were much more Ngf-immunoreactive nerve cells expressed in the dorsal horn in sciatic nerve cryoneurolysis rats with hyperalgesia. PMID: 22580175

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.