Recombinant Rat CNTF Protein
Beta LifeScience
SKU/CAT #: BLA-2012P
Recombinant Rat CNTF Protein
Beta LifeScience
SKU/CAT #: BLA-2012P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P20294 |
Synonym | Ciliary neurotrophic factor CNTF CNTF_HUMAN HCNTF |
Description | Recombinant rat CNTF Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLD SVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPT EGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM |
Molecular Weight | 23 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using Human TF-1 cells is less than 30 ng/mL, corresponding to a specific activity of > 3.3 x 104 IU/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |