Recombinant Rat CNTFR Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-2015P
Recombinant Rat CNTFR Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-2015P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | Q08406 |
Synonym | Ciliary neurotrophic factor receptor Ciliary neurotrophic factor receptor alpha Ciliary neurotrophic factor receptor subunit alpha CNTF Receptor alpha CNTF receptor subunit alpha CNTFR CNTFR Alpha CNTFR-alpha CNTFR_HUMAN |
Description | Recombinant Rat CNTFR Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein |
Source | Baculovirus infected insect cells |
AA Sequence | QKHSPQEAPHVQYERLGTDVTLPCGTASWDAAVTWRVNGTDLAPDLLNGS QLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYP KGFYCSWHLSAPTYIPNTFNVTVLHGSKMMVCEKDPALKNRCHIRYMHLF STIKYKVSISVSNALGHNTTAITFDEFTIVKPDPPENVVARPVPSNPRRL EVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSNGTAHTITDAYA GKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAPETTTST TSSLAPPPTTKICDPGELSSLEHHHHHH |
Molecular Weight | 37 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |