Recombinant Rat Collagen Alpha-1 (COL1A1) Protein (His)

Name: Recombinant Rat Collagen Alpha-1 (COL1A1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10298P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Car-t cell therapy targets, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Collagen Alpha-1 (COL1A1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P02454
Target Symbol	COL1A1
Synonyms	Col1a1Collagen alpha-1(I) chain; Alpha-1 type I collagen
Species	Rattus norvegicus (Rat)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA
Expression Range	955-1207aa
Protein Length	Partial
Mol. Weight	25.4kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Type I collagen is a member of group I collagen (fibrillar forming collagen).
Subcellular Location	Secreted, extracellular space, extracellular matrix.
Protein Families	Fibrillar collagen family
Database References	KEGG: rno:29393 STRING: 10116.ENSRNOP00000005311 UniGene: Rn.2953
Tissue Specificity	Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Gene Functions References

the activation of Pin1 promoted cardiac extracellular matrix deposition and oxidative stress damage by regulating the phosphorylation of the MEK1/2ERK1/2 signaling pathway and the expression of alphaSMA. PMID: 29286102
In vitro analysis using LX2 HSC cells indicated that ATII can augment TGFbeta1 and collagen type I alpha1 mRNA expression via periostin expression, suggesting that the interaction between ATII and periostin may serve a role in liver fibrosis development. In conclusion, blockade of ATIIinduced periostin may suppress the progression of liver fibrosis development. PMID: 28849131
miR21 regulates expression of alphaSMA and collagen I in activated rat hepatic stellate cells by directly targeting Smad7. PMID: 28731181
Taken together, the lentiviral RNAi vector targeting the TGF beta-1 gene of rats was successfully constructed, which effectively silenced the TGF beta-1 gene of the HSCT6 cells and inhibited the expression of Col1a1. PMID: 28713909
the diagnostic value of urinary collagen degradation products in a proteinuria-driven fibrosis rat model, was investigated. PMID: 28320405
Brefeldin A induced a significant up-regulation of Col1a1 mRNA levels in CFSC-2G hepatic stellate cells that was time-dependent. The UPR correlated with enhanced mRNA and protein levels of collagen type I in these cells. Analysis of the 3 branches of UPR revealed the activation of IRE1alpha, PERK and ATF6 in response to BFA. An IRE1alpha-p38 MAPK-Smad pathway may be responsible for the fibrogenic action of BFA on HSC. PMID: 27155082
treatment with LG ameliorated STZ-induced DN via the inhibition of oxidonitrosative stress as well as downregulation of KIM-1, NGAL, TGF-beta1, and collagen-1 mRNA expressions. PMID: 27756197
In a liver fibrosis cellular model, tenascin-C promotes migration of hepatic stellate cells and production of type I collagen via TGF-beta1 and alpha9beta1 integrin pathway. PMID: 27031437
Liganded vitamin D receptor through its interacting repressor inhibits the expression of Col1a1. PMID: 27351590
In a pure VO model, chymase produced in adult cardiac fibroblasts leads to autophagic degradation of newly synthesized intracellular procollagen I, suggesting a new role of chymase in extracellular matrix degradation PMID: 26807691
signaling through Na/K-ATPase regulates miRNAs and specifically, miR-29b-3p expression both in vivo and in vitro. PMID: 26702050
A reciprocal regulatory relationship between DDR2 and collagen, involving cross-talk between the GPCR and RTK pathways, is central to Angiotensin II-induced increase in collagen expression in cardiac fibroblasts. PMID: 26674152
Preferential sites for intramolecular glucosepane cross-link formation in type I collagen has been described. PMID: 26049074
The present findings suggest that prolyl 3-hydroxylation incrementally regulates collagen fibril diameter in tendon. PMID: 26567337
Flouride affected collagen I arrangement and produced ultrastructural changes in bone tissue. Meanwhile, the mRNA expression of COL1A1 and COL1A2 were reduced and the COL I protein levels decreased in the fluorosis group. PMID: 25655816
High Collagen Type I expression is associated with renal fibrosis in experimental kidney diseases. PMID: 25784725
Increased expression of Acan and Col2a1 along with decreased expression of Col1a1 and Mmp13 indicated formation of hyaline cartilage in this group. PMID: 25128628
These data support the hypotheses that, in dentin, the interaction between COL1 and PP may initiate crystal nucleation and that additional interactions between PP and the growing crystals may modulate the crystal growth pattern and crystal size. PMID: 15609627
Fetal and adult human skin fibroblasts retain their differential proliferative response to TGF-beta when cultured in the presence of fibronectin and unpolymerized or polymerized collagen. PMID: 24735795
Regional differences in cell proliferation and fibronectin structure were dependent on both soluble fibronectin concentration and fibronectin-collagen type I interactions. PMID: 24116223
This study suggests that laminin and type I collagen support the function of folliculostellate cells by increasing fibromodulin protein expression in the anterior pituitary. PMID: 23959432
The naive effector cells of collagen type I during acute experimental pancreatitis are acinar cells and not pancreatic stellate cells PMID: 24036265
Data suggest that miR-711-SP1-collagen-I pathway may be strategies for miRNA-based anti-fibrotic drug research. PMID: 23633075
The DNMT-mediated DNA methylation is an important mechanism in regulating the TGF-beta1-induced COL1A1 gene expression. PMID: 23560091
Hypothesized that reducing collagen I accumulation in glomerulosclerosis would lower Hic-5 expression,reducing apoptosis, and maintain glomerular integrity. NTU281 treatment reduced glomerular col I accumulation, Hic-5 and alpha-SMA expression, and apoptosis. PMID: 23508044
These findings suggest that amide I nonlinear optical chiral effects in type I collagen assemblies arise predominantly from the chiral organization of amide chromophores within individual collagen molecules, rather than from supramolecular structures. PMID: 23200051
Hypoxia alone can upregulate DNA synthesis and expression of collagen type I and III mRNA in adult rat cardiac fibroblasts. PMID: 21166192
Crystal structures of Hsp47 in its free form and in complex with homotrimeric synthetic collagen model peptides, are presented. PMID: 22847422
Curcumin could suppress bleomycin-induced pulmonary fibrosis by inhibiting the synthesis and deposition of type I collagen and reducing expression of TGF-beta1. PMID: 18727865
These data demonstrate a relationship between miR-133a and Col1A1, suggesting that myocardial fibrosis occurring in Ang II-dependent hypertension is regulated by the down-regulation of miR-133a and miR-29b through the modulation of Col1A1 expression. PMID: 21769867
S-adenosyl-L-methionine inhibits Col1A1 processing leading to increased ubiquitination and decreased secretion. PMID: 21645221
The regulatory effect of melatonin (MLT)cannot be explained by its effect on procollagen gene expression, since neither MLT nor pinealectomy is shown to have an influence on alpha1 (I) and alpha1 (III) procollagen mRNA content in the scar. PMID: 20388018
High fat diet reduces the levels of type I tropocollagen and adiponectin and these effects are deleterious for skin function. PMID: 20397200
Bushen Rougan Recipe can decrease the expressions of collagen type I and CTGF mRNAs in rats with hepatic fibrosis. PMID: 18782537
Craniofacial growth and type I collagen gene expresion in the rat occur mainly between days 10 and 21. PMID: 20149607
AT2 receptor is involved in collagen metabolism in cardiac fibroblasts by regulating the levels of Col I and TIMP-1 mRNA. PMID: 18095594
Data support that post-translational glycosylation of collagen I has a role in the induction in endothelial cells in vitro of molecules conductive to self-organization in vessels-like structures. PMID: 20006603
Deducted interpretations from our experimental approach suggest that Ang II stimulates indirectly (via SNS) and inhibits directly (via AT1 receptors) the collagen type I at transcriptional and protein levels. PMID: 19679517
Type I collagen gene expression is affected by mechanical loading. PMID: 11924646
Gene expression of TGF-beta1, type I collagen, and connective tissue growth factor using primary cultured pancreatic stellate cells. PMID: 12199527
p38 MAPK mediates the regulation of alpha1(I) procollagen mRNA levels by TNF-alpha and TGF-beta in a cell line of rat hepatic stellate cells PMID: 12297293
hypoxic enhancement of the posttranscriptional step of collagen synthesis contributed to the accelerated deposition of collagen fibrils PMID: 12408871
dental pulp contains competent progenitor cells capable of differentiating into new generations of odontoblast-like cells which express high levels of Col1a1-2.3-GFP PMID: 12755333
TRAM2, as a part of the translocon, is required for the biosynthesis of type I collagen by coupling the activity of SERCA2b with the activity of the translocon PMID: 14749390
both p38 MAPK and Smad signaling independently and additively regulate alpha1(I) collagen gene expression by transcriptional activation PMID: 15647278
Results show that 70-kDa ribosomal S6 kinase plays a crucial role in hepatic stellate cell proliferation, collagen type I expression, and cell cycle control, thus representing a potential therapeutic target for liver fibrosis. PMID: 15677443
Results conclude that residues 19-46 of bone sialoprotein represent a novel collagen-binding site. PMID: 15703183
Endo180 binds to the C-terminal region of type I collagen, and this interaction appears to play an important role in cell-matrix adhesion PMID: 15817460
Our results demonstrate that inhibition of alphaI(I)-collagen gene expression by curcumin in activated HSCs results from suppression of CTGF gene expression through increasing cellular GSH contents and interruption of TGF-beta signaling. PMID: 16306131
Data present a crystallographic determination of the collagen type I supermolecular structure. PMID: 16751282

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.