Recombinant Rat CXCL17/DMC Protein
Beta LifeScience
SKU/CAT #: BLA-2249P
Recombinant Rat CXCL17/DMC Protein
Beta LifeScience
SKU/CAT #: BLA-2249P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | D4A875 |
Synonym | 13.6 kDa protein C-X-C motif chemokine 17 chemokine (C-X-C motif) ligand 17 CXCL17 Dcip1 Dendritic cell and monocyte chemokine-like protein DMC UNQ473 UNQ473/PRO842 VCC1 VEGF co-regulated chemokine 1 |
Description | Recombinant rat CXCL17/DMC Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | SPNQEVARHHGDQHQAPRRWLWEGGQECDCKDWSLRVSKRKTTAVLEPPR KQCPCDHVKGSEKKNRRQKHHRKSQRPSRTCQQFLKRCQLASFTLPL |
Molecular Weight | 12 kDa |
Purity | >97% SDS-PAGE.>97% as determined by SDS-PAGE and HPLC. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/ml, corresponding to a specific activity of >200 IU/mg |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C or -20°C. Avoid freeze / thaw cycle. |