Recombinant Rat CXCL9 Protein
Beta LifeScience
SKU/CAT #: BLA-2253P
Recombinant Rat CXCL9 Protein
Beta LifeScience
SKU/CAT #: BLA-2253P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | Q8K4B1 |
Synonym | C-X-C motif chemokine 9 chemokine (C-X-C motif) ligand 9 CMK crg-10 CXCL9 CXCL9_HUMAN gamma interferon induced monokine Gamma-interferon-induced monokine HuMIG MIG monokine induced by gamma interferon monokine induced by interferon gamma Monokine induced by interferon-gamma SCYB9 Small inducible cytokine B9 small inducible cytokine subfamily B member 9 Small-inducible cytokine B9 |
Description | Recombinant Rat CXCL9 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | TLVIRNQRCSCISTSQGTFHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQ TCLDPDSARVKKLMKEWEKKISQKKKQKRGKNHQRSKKTRKAKTPHHPES KKTA |
Molecular Weight | 12 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle. |