Recombinant Rat EGF Protein
Beta LifeScience
SKU/CAT #: BLA-1849P
Recombinant Rat EGF Protein
Beta LifeScience
SKU/CAT #: BLA-1849P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P07522 |
Synonym | Beta urogastrone beta-urogastrone EGF EGF_HUMAN Epidermal growth factor HOMG4 OTTHUMP00000219721 OTTHUMP00000219722 Pro epidermal growth factor URG Urogastrone |
Description | Recombinant rat EGF Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRW WKLR |
Molecular Weight | 6 kDa |
Purity | >95% SDS-PAGE.Protein Content and Purity (typically = 95%) determined by: HPLC, Reducing and Non-reducing SDS-PAGE, UV spectroscopy at 280 nm. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The activity is determined by the dose-dependent proliferation of mouse BALB/c 3T3 cells and is typically less than 0.1 ng/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA). |