Recombinant Rat ErbB2 Protein
Beta LifeScience
SKU/CAT #: BLA-8205P
Recombinant Rat ErbB2 Protein
Beta LifeScience
SKU/CAT #: BLA-8205P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P06494 |
Synonym | Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog C erb B2/neu protein CD340 CD340 antigen Cerb B2/neu protein CerbB2 Erb b2 receptor tyrosine kinase 2 ErbB-2 proto-oncogene ERBB2 ERBB2_HUMAN HER 2 HER 2/NEU HER2 Herstatin Human epidermal growth factor receptor 2 Metastatic lymph node gene 19 protein MLN 19 MLN19 NEU NEU proto oncogene Neuro/glioblastoma derived oncogene homolog Neuroblastoma/glioblastoma derived oncogene homolog NGL p185erbB2 Proto-oncogene c-ErbB-2 Proto-oncogene Neu Receptor tyrosine-protein kinase erbB-2 TKR1 Tyrosine kinase type cell surface receptor HER2 Tyrosine kinase-type cell surface receptor HER2 V erb b2 avian erythroblastic leukemia viral oncogene homolog 2 V erb b2 avian erythroblastic leukemia viral oncogene homolog 2 (neuro/glioblastoma derived oncogene homolog) V erb b2 avian erythroblastic leukemia viral oncoprotein 2 V erb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog V erb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) |
Description | Recombinant Rat ErbB2 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALA VLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQ DMVLWKDVFRKNNQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQI LTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGIC ELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLV CPPNNQEVHHHHHH |
Molecular Weight | 29 kDa including tags |
Purity | >95% SDS-PAGE.Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. The lyo |