Recombinant Rat FGF18 Protein
Beta LifeScience
SKU/CAT #: BLA-1854P
Recombinant Rat FGF18 Protein
Beta LifeScience
SKU/CAT #: BLA-1854P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | O88182 |
Synonym | FGF 18 FGF-18 Fgf18 FGF18_HUMAN FGFI Fibroblast growth factor 18 zFGF5 |
Description | Recombinant rat FGF18 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARG EDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKEC VFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKR YPKGQTELQKPFKYTTVTKRSRRIRPTHPG |
Molecular Weight | 21 kDa |
Purity | >95% SDS-PAGE.> 95 % by HPLC. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 106 IU/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. |