Recombinant Rat Fibroblast Growth Factor 2 (FGF2), Active
Beta LifeScience
SKU/CAT #: BLC-05920P
Greater than 95% as determined by SDS-PAGE.
Recombinant Rat Fibroblast Growth Factor 2 (FGF2), Active
Beta LifeScience
SKU/CAT #: BLC-05920P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Fibroblast Growth Factor 2 (FGF2), Active is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 0.3-1.8 ng/ml. |
Uniprotkb | P13109 |
Target Symbol | FGF2 |
Synonyms | Fgf2; Fgf-2Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2 |
Species | Rattus norvegicus (Rat) |
Expression System | E.coli |
Tag | Tag-Free |
Complete Sequence | ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Expression Range | 11-154aa |
Protein Length | Partial |
Mol. Weight | 16.2 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
Target Function | Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation. |
Subcellular Location | Secreted. Nucleus. |
Protein Families | Heparin-binding growth factors family |
Database References | |
Tissue Specificity | Found in all tissues examined. |
Gene Functions References
- Dual delivery of bFGF and NGF binding coacervate was neuroprotective via stimulating the growth and proliferation of neurons. PMID: 29895019
- FGF2 protects against renal ischemia-reperfusion injury by attenuating mitochondrial damage and proinflammatory signaling. PMID: 28544332
- Study shows that fibroblast growth factor 2-ERK1/2 pathway is involved in the pathophysiology of depressive-like behaviors, and manipulating the neurogenesis pathway is a viable therapeutic approach to inflammation-associated depression. PMID: 28529071
- These findings may offer insight to help us understand more as to how bFGF ASODN can effectively suppress the proliferation and differentiation of NSCs. PMID: 28390174
- the present findings demonstrate that OCT alone or in combination with bFGF accelerates nerve repair in a large peripheral nerve defect in rats. PMID: 27529414
- Effect of basic fibroblast growth factor released from chitosan-fucoidan nanoparticles on neurite extension PMID: 23696519
- Thus, FGF2 is an alcohol-responsive gene constituting a positive regulatory feedback loop with alcohol. This loop leads to facilitation of alcohol consumption, marking FGF2 as a potential new therapeutic target for alcohol addiction. PMID: 28821667
- attempted to identify PKGII-targeted proteins, which are associated with the inhibition of FGF2-induced MAPK activation PMID: 28057484
- a moderate level of FGF-2 expression was observed in the cells within the connective tissue of the healing wounds of the normoglycemic group on all days evaluated which differed from that observed in the wounds of the diabetic group PMID: 27188585
- overexpression of BNIP3L in H9C2 cardiomyoblast cells reduced the cardioprotection of FGF-2 in hydrogen peroxide-induced necrosis and mitochondrial dysfunction. PMID: 28006775
- The induction of active beta-catenin and then fibronectin turnover in response to bFGF were markedly increased in pulmonary fibroblasts from rat with COPD. beta-Catenin/RhoA pathway results in ECM deposition in lung fibroblasts and myofibroblasts differentiation. PMID: 27734223
- It plays an important role as a key trigger of Intramuscular adipose tissue formation in vivo. PMID: 26154243
- This study demonstrated that altered Cx43 expression modulates bFGF expression, which correlates with prolactinoma development. PMID: 27078698
- Basic fibroblast growth factor increased in spinal microglia during the development of allodynia after spinal nerve ligation. PMID: 26583471
- TGF-beta1 was upregulated with FGF-2 treatment, and alpha-SMA expression induced by FGF-2 was inhibited after the cell was transferred with TGF-beta1 siRNA. PMID: 26729053
- Apocynin attenuated cardiac injury in type 4 radiorenal syndrome rats via inhibiting NADPH oxidase-dependent oxidative stress-activated ERK1/2 pathway and subsequent FGF-2 upregulation. PMID: 26109504
- Astrocyte-secreted FGF2 mediated stress-hormone-induced neural stem cell proliferation. PMID: 23599891
- Basic fibroblast growth factor and neurotrophin-3, which are released from astrocytes by exposure to thyroid hormone, influence each other to enhance Na+ current density in cultured hippocampal neurons. PMID: 26009773
- GK-2 had no effect on the expression level of FGFb and NT4, however, promoted an increase in the expression level of BDNF. PMID: 26571801
- FGF-2 in dissociated postnatal retinal cell cultures and found that FGF-2 is a potent factor triggering ganglion cell differentiation PMID: 25402196
- Regional differences in the FGF-2 expression pattern as either the first or the second injection of cocaine by themselves upregulated FGF-2 mRNA in the medial prefrontal cortex and nucleus accumbens while downregulating it in the hippocampus. PMID: 25124315
- fibroblast growth factor 2has roles in maintenance of the undifferentiated state and in proliferation of Endothelial progenitor cells , allowing EPC to maintain the potential to differentiate to Endothelial Cells. PMID: 24694617
- Subsarcolemmal mitochondria are more responsive than interfibrillar mitochondria to FGF-2-triggered protection from calcium-induced permeability transition, by a Cx43 channel-mediated pathway. PMID: 24654232
- It was found that cultivation of the cells under hypoxic conditions and bFGF is an optimum to maintain high viability and proliferation capacity of the mesenchymal stem cells. PMID: 25715620
- The learning impairment in IL-1beta-treated rats is accompanied by lower FGF-2 mRNA levels in medial prefrontal cortex and ventral (not dorsal) hippocampus, but TIMP-1 was not affected. PMID: 25697011
- astroglial cell maturation is enhanced by bFGF through induction of miR-134 PMID: 25482448
- bFGF-induced differentiation of dorsal root ganglia stem cells toward Schwann cells might be mediated by binding to fibroblast growth factor receptor-1 (FGFR-1) through activation of MAPK/ERK signal pathway. PMID: 24072480
- It is one of the key players in the origin and growth of neuronal and glial cells through autocrine and paracrine signaling. PMID: 24707873
- implicate FGF2 as a modifier of epigenetic mechanisms associated with emotional responsiveness, and point to H3K9me3 as a key player in the regulation of affective vulnerability PMID: 25071177
- enhanced protein kinase C levels, reduction of basic FGF expression, and increased in apoptosis might be associated with the development of diabetes-induced myoatrophy PMID: 24008114
- Studied the change of FGF-2 and IGF-1 in serum and bone callus after fracture in diabetic rats, and explored molecular biological mechanism of healing of diabetic fracture. PMID: 24418087
- TGF-beta1 and FGF2 induce the epithelial-mesenchymal transition of Hertwig's epithelial root sheath through a MAPK/ERK-dependent signaling pathway. PMID: 24610459
- Following FGF2 treatment, however, bHR-bLR differences in CCK and FGF-R1 mRNA expression were eliminated, due to decreased CCK mRNA levels PMID: 24121132
- Retinal injury may enhance neurotrophic factor expression in mesenchymal stem cells and promote the repair process. PMID: 24030359
- matrix proteoglycans such as perlecan serve as functional docking platforms for FGF2 in chronic transplant dysfunction. PMID: 24035513
- Basic fibroblast growth factor contributes to a shift in the angioregulatory activity of retinal glial (Muller) cells. PMID: 23861940
- With an increase in the degree of pressure ulcers, the expression of VEGF and bFGF in pressure ulcers tissue are decreased. This leads to a reduction in angiogenesis and may be a crucial factor in the formation of pressure ulcers. PMID: 23740668
- This study provides evidence that E and FGF2 exert a cooperative effect on the lactotroph proliferation principally by signaling initiated at the plasma membrane. PMID: 23651845
- Psychological stress could delay periodontitis healing in rats, which may be partly mediated by downregulation of the expression of bFGF in the periodontal ligament. PMID: 23326020
- We conclude that FGF-2 secreted by bone marrow-derived cells strongly increases early glial proliferation, which can potentially improve peripheral nervous system regeneration. PMID: 22793996
- FGF-2 induced the phosphorylation of Akt and its substrate, glycogen synthase kinase 3beta (GSK3beta) in addition to three MAP kinases in rat glioma cells. PMID: 22575563
- Spinal cord treatment of lesion with sciatic nerve and sciatic nerve plus FGF-2 allows recovery of hind limb movements compared to control, manifested by significantly higher behavioral scores after surgery. PMID: 22555431
- Inhibitng bFGF alleviates bleomycin-induced pulmonary fibrosis in rats. PMID: 20684286
- bFGF promote the proliferation and migration of endothelial progenitor cells, the effects of bFGF being implemented by activating ERK signalling through the expression of Pdgfrb. PMID: 22731705
- The epithelial and smooth muscle cell hyperplasia and increased Fgf-2 expression observed in this experimental model of obesity/insulin-resistance might explain the high frequency of benign prostatic hyperplasia in insulin-resistant men. PMID: 22661309
- bFGF gene expression is elevated following cerebral concussion, and might play an important role in cell degeneration and necrosis. PMID: 12857442
- Data suggest that molecular mechanism of dihydrotestosterone induction of Pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4) during spermatogenesis involves stimulation of Sertoli cells to secrete FGF-2. PMID: 22811469
- FGF-2 gene expression is significantly elevated from day 1 to day 14; the increase in FGF-2 protein level is most evident at day 7; cells expressing FGF-2 are primarily endothelial cells following myocardial infarction. PMID: 20674996
- The expression of VEGF and bFGF is significantly increased after stromal cell transplantation therapy during the late phase of acute myocardial infarction. PMID: 21162206
- astrocyte migration to injury sites may be a key factor in the repair mechanisms orchestrated by FGF2. PMID: 22189091