Recombinant Rat Galectin-3 (LGALS3) Protein (His)

Name: Recombinant Rat Galectin-3 (LGALS3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03915P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals3.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Galectin-3 (LGALS3) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P08699
Target Symbol	LGALS3
Synonyms	Lgals3; Galectin-3; Gal-3; 35 kDa lectin; Carbohydrate-binding protein 35; CBP 35; Galactose-specific lectin 3; IgE-binding protein; Laminin-binding protein; Lectin L-29; Mac-2 antigen
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTSASHAMI
Expression Range	2-262aa
Protein Length	Full Length of Mature Protein
Mol. Weight	31.1 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis.
Subcellular Location	Cytoplasm. Nucleus. Secreted.
Database References	KEGG: rno:83781 STRING: 10116.ENSRNOP00000014216 UniGene: Rn.764

Gene Functions References

Galectin-3 is a crucial factor in inducing pulmonary artery endothelium cell transformation into VSMCs through Jagged1/Notch1 dependent MyoD and SRF expression in this pathological condition PMID: 30463073
that lack of Gal3 worsens subchronic injury after neonatal focal stroke PMID: 27836669
Therapeutic silencing of galectin3 improves cardiomyocyte apoptosis and survival during heart failure. PMID: 29286090
Gal-3 serves as a critical regulator in the pathogenesis of pulmonary arterial hypertension by regulating the proliferation, differentiation, and extracellular matrix deposition synthesis of pulmonary adventitial fibroblast. PMID: 28826890
Gal-3 is overexpressed in aorta and AVs from PO rats. Gal-3 pharmacological inhibition blocks aortic and AV remodeling in experimental PO. Gal-3 could be a new therapeutic approach to delay the progression and the development of aortic remodeling and AV calcification in PO. PMID: 28758988
Gal-3 plays an important role in the pulmonary arterial hypertension-induced right ventricular remodeling through interacting with the Nox4 and Nox4-derived oxidative stress. PMID: 28431936
These findings demonstrate that Gal-3 is required for TGF-beta1-stimulated vascular fibrosis via a STAT3 signaling cascade and that MMP-9 is also involved in TGF-beta1/Gal-3-induced vascular fibrosis. PMID: 27870162
The increase in myocardial Gal-3 expression was associated with cardiac fibrosis and inflammation. PMID: 28360193
galectin-3 expression in the rat brain seems to be regulated by developmental cascades, and functionally and neuroanatomically related brain nuclei constitutively express galectin-3 in adulthood. PMID: 28255782
Data suggest that inhibition of galectin-3 (here, by soluble dietary fiber supplement, modified citrus pectin) prevents initiation/progression of liver cirrhosis by inducing apoptosis in liver stellate cells. PMID: 27010252
Up-regulated galectin-3 signaling might be involved in the pathogenesis in experimental cardiorenal syndrome PMID: 26875907
Findings suggest the involvement of GAL-3 in the glycation and oxidative stress under diabetic conditions and its cytoprotective role in Schwann cells. PMID: 25481849
This study provides a new insight into the molecular mechanisms of HF mediated by PKC-alpha and galectin-3. PMID: 25489662
galectin-3 is activated in microglia and macrophages according to the progression of glioma. PMID: 23179497
Gal-3 is required for inflammatory and fibrotic responses to aldosterone in vascular smooth muscle. PMID: 23117656
Galectin-3 expression is induced in macrophages, particularly ED1+ macrophages, during the course of wound healing. PMID: 21435650
The morphometric analysis showed a significant decrease in the frequency of myelinated axons, myelin turns (lamellae) and g-ratio in the corpus callosum and striatum of Lgals3(-/-) compared with wild-type (WT) mice. PMID: 21566659
Our results identify a cell type-specific control of galectin-3 synthesis by glucocorticoids in lung bronchiolar Clara cells and interstitial macrophages PMID: 21472689
Abnormally lower level of galectin-3 expression and elevated level of rno-let-7d expression were observed in brain of SHR than those in WKY rat. PMID: 20557304
Basal expression and secretion levels of rat gal-3 are higher in glioma cells compared with normal rat primary astrocytes; upregulated interferon-gamma levels in virally infected glioma cells increase gal-3 secretion into the culture media. PMID: 20980634
galectin-3 may be involved in the complex process of kidney regeneration following ischemia/reperfusion injury PMID: 20865664
Inhibition of galectin-3 using RNAi technique can suppress proliferation and induce apoptosis in hepatic stellate cells. PMID: 19785949
MP20 ia a galectin-3 ligand PMID: 11532191
galectin 3 controls proliferation in thyroid cells PMID: 12615069
data suggest complex induction mechanisms of gal-3 expression in neuronally differentiating PC12 cells involving NGF-, but not CNTF- and IL-6-driven (in NGF-primed cells) Ras/MAPK-related signalling pathways PMID: 14622091
Galectin-3 is the major LDN-binding protein in macrophages. Galectin-3 can mediate recognition and phagocytosis of LDN-coated particles by macrophages. PMID: 15265923
An early increase in galectin-3 expression identifies failure-prone hypertrophied hearts. Galectin-3, a macrophage-derived mediator, induces cardiac fibroblast proliferation, collagen deposition, and ventricular dysfunction. PMID: 15520318
Osteoblastic exposure to irreversible advanced glycation endproducts alters their expression and secretion of galectin-3, which could have significant consequences on osteoblast metabolism and thus on bone turnover. PMID: 15646023
Thus galectin-3 may play several important roles in the CCD, including mediating the adaptation of beta-intercalated cells during metabolic acidosis. PMID: 16131647
siRNA knockdown of Galectin-3 inhibited myofibroblast activation after hepatic injury and may therefore provide an alternative therapeutic approach to the prevention and treatment of liver fibrosis PMID: 16549783
Combined proteome-transcriptome-genome and functional analyses identify gal-3 as a candidate gene/protein in Type 1 diabetes. susceptibility PMID: 16600178
galectin-3 promotes K-Ras signaling to both Raf and PI3-K. 3. PMID: 16691442
Galectin-3 is expressed in the neonatal, young, and mature rat intervertebral disc. PMID: 17202886
Galectin-3 was localized to polymorphonuclear neutrophils, microglia, monocytes and macrophages, suggesting an involvement of galectin-3 in the neuroinflammatory processes leading to brain damage in PM. PMID: 17706429
Abundant galectin-3 observed in the area of severe bone destruction may act as a negative regulator for the upregulated osteoclastogenesis accompanying inflammation to prevent excess bone destruction. PMID: 19015643
These results suggest that Gal-3 expressed by activated microglia/infiltrating macrophages and astrocytes in the ischemic brain may play a role in post-ischemic tissue remodeling by enhancing angiogenesis and neurogenesis. PMID: 19573520

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.