Recombinant Rat GDNF Protein
Beta LifeScience
SKU/CAT #: BLA-1871P
Recombinant Rat GDNF Protein
Beta LifeScience
SKU/CAT #: BLA-1871P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | Q07731-1 |
Synonym | Astrocyte derived trophic factor Astrocyte derived trophic factor 1 Astrocyte-derived trophic factor Atf ATF 1 ATF 2 ATF1 ATF2 gdnf GDNF_HUMAN Glial cell derived neurotrophic factor Glial Cell Line Derived Neurotrophic Factor Glial cell line-derived neurotrophic factor Glial derived neurotrophic factor HFB1 GDNF hGDNF HSCR3 |
Description | Recombinant rat GDNF Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLN VTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQ ACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI |
Molecular Weight | 15 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | C6 cell proliferation (typical ED50 is <0.1 ug/mL). |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at room temperature. Store at -20°C. |