Recombinant Rat HGF Protein (Tagged)

Name: Recombinant Rat HGF Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-2016P
Availability: InStock

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Rat
Accession	P17945
Synonym	DFNB39 F TCF Fibroblast derived tumor cytotoxic factor Hepatocyte growth factor Hepatocyte growth factor (hepapoietin A; scatter factor) Hepatocyte growth factor beta chain Hepatocyte growth factor precursor Hepatopoietin A Hepatopoietin-A Hgf HGF_HUMAN HGFB HPTA Lung fibroblast derived mitogen OTTHUMP00000161349 OTTHUMP00000206710 OTTHUMP00000206711 OTTHUMP00000206712 OTTHUMP00000206713 OTTHUMP00000206730 Scatter factor SF
Description	Recombinant Rat HGF Protein (Tagged) was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	TIVNLDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIK ESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYG PEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLI NADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDY GGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTY KL
Molecular Weight	55 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization.
Protein Families	Peptidase S1 family, Plasminogen subfamily
Database References	KEGG: rno:24446 STRING: 10116.ENSRNOP00000009764 UniGene: Rn.10468

Gene Functions References

HGF significantly mitigated the severity of pulmonary artery hypertension (PAH) and inhibited inflammation by attenuating the NF-kB signaling in the lungs of PAH rats. PMID: 29442198
Our results suggest that hUCMSCs can promote ovarian expression of HGF, VEGF, and IGF-1 through secreting those cytokines, resulting in improving ovarian reserve function and withstanding ovarian senescence. PMID: 28279229
eIf2alpga expression was upregulated during endoplasmic reticulum stress and interfering eIf2alpha expression proportionately down-regulated HGF expression. PMID: 28844859
VEGF treatment increases expression of HGF in vitro and in vivo and that, based on a series of integrative studies, we suggest that the effects of VEGF are mediated through downstream HGF signaling. PMID: 27036872
Hepatocyte growth factor (Hgf) plays a crucial role in the formation of the muscular diaphragmatic components by regulating the migration of myogenic progenitor cells into the primordial diaphragm. PMID: 27480986
Mesenchymal stem cells restore lung vascular permeability and alleviate lung injury in part by maintaining HGF levels. PMID: 27129877
The mechanism of antifibrogenic action of OBE is hypothesized to proceed via scavenging free radicals and activating liver regeneration by induction of HGF. PMID: 26213907
Data show that secretion of hepatocyte growth factor (HGF) was elevated, tumour necrosis factor-alpha (TNF-alpha) and transforming growth factor-beta1 (TGF-beta1) levels were decreased after infusion of mesenchymal stem cells. PMID: 25736907
HGF induction is a crucial contributor to the acceleration of cell dedifferentiation and growth. PMID: 25793303
HGF was hardly detectable in normal tympanic membrane; however, a significant increase was noted in its expression starting from the third day after injury throughout the follow-up period, with the highest level on day 05. PMID: 25920966
p27 haploinsufficiency protects against heart injury by VEGF/HGF mediated cardioprotection and increased angiogenesis through promoting IKK activation. PMID: 25099287
spleen seemed to exhibit an inhibitory effect on liver regeneration by downregulating HGF and its receptor c-Met in the liver PMID: 25862490
Mesenchymal stromal cells increased serum and tissue HGF levels, Met tubular expression and prevented the suppression of tubular MSP/RON expression. PMID: 25277788
Hepatocyte growth factor upregulates nexilin gene expression in cardiomyocytes via JNK pathway. PMID: 25062485
Studied the preventive and control effect of matrine on transforming growth factor (TGF-beta1) and hepatocyte growth factor (HGF) of liver fibrosis tissue in rats. PMID: 25063067
Transplanted mesenchymal stem cells expressing human HGF combined with G-CSF potentially offer synergistic therapeutic benefit for the treatment of pulmonary arterial hypertension. PMID: 23933910
cytoskeletal rearrangement and cell-cell adhesion, such as through VE-cadherin and ZO-1, are candidate mechanisms for the influence of HGF on the blood-brain barrier PMID: 24370951
these results indicate that HGF activates the cMetAktTGIF signaling pathway, inhibiting CF proliferation and transformation in response to TGFb1 stimulation. PMID: 24840640
Fibroblasts activated by hepatoma cell supernatant express COX-2 and HGF at higher levels. PMID: 24815169
HGF/c-Met signaling pathway plays an essential role in the homing of MSCs towards injured liver triggered by intestinal ischemia-reperfusion, and then mediates MSC-induced liver repair. PMID: 24782653
results indicated that HGF, MMP-9 and TGF-beta1 may participate in the formation and prognosis of hydrocephalus. PMID: 23270462
the results provide evidence that HGF can accelerate reepithelialization in skin wound healing by dedifferentiation of epidermal cells in a manner related to the b1-integrin/ILK pathway. PMID: 24490163
This data indicates that hypoxic modulation of satellite cell-mediated angiogenesis involves a reduction in satellite cell HGF expression. PMID: 24122166
These results strongly suggest that the combined stimulation of IL-6 and glucocorticoids induces the activation of both Reg and HGF genes. PMID: 23954444
HGF is important in the repair of the dentine-pulp complex potentially participating in several aspects of wound healing. PMID: 23273597
HGF is a growth factor playing a key role in islet mass increase and hyperinsulinemia in diet-induced obesity rats; the HGF-Met axis may have a role on insulin signaling in the liver PMID: 23024263
HGF, bFGF and VEGF significantly increased the growth of vascular endothelial cells. PMID: 22361334
The renal fibrosis of CAAN could be protected by isogenic MSC transplantation, probably via upregulation of HGF and downregulation of TGF-beta1. PMID: 22661380
The antifibrotic effects of Astragalus mongholicus may be associated with up-regulation of HGF expression and down-regulation of TGF-beta1 expression in rats with unilateral ureteral obstruction. PMID: 19069655
HGF is a biomarker and mediator in cardioprotection and cardiovascular regeneration [review] PMID: 22318499
The data showed that the activation of hepatocyte growth factor/c-Met signaling is a major pathway involved type II cell proliferation induced by ultrafine carbon black. PMID: 22245998
Upregulation of miRNA-29 by HGF and downregulation by TGF-beta take part in the anti- or profibrogenic response of HSC, respectively PMID: 21931759
in the same stages, hepatocyte growth factor reduces the amount of actin present in the blood testis barrier region, in which occludin levels are highest and modifies the morphology of the actin cytoskeleton network PMID: 21843593
Hepatocyte growth factor-induced amelioration in renal interstitial fibrosis is associated with reduced expression of alpha-smooth muscle actin and transforming growth factor-beta1 PMID: 22165288
HGF and VEGF participate in the pathological injury and repair of cerebral tissue in rats with chronic hydrocephalus after subarachnoid hemorrhage. PMID: 21643626
Both HGF and glial cell line-derived neurotrophic factor (GDNF) have significant neurotrophic effects, but only HGF can promote neurogenesis, angiogenesis, and synaptogenesis and inhibit fibrosis in brains after transient middle cerebral artery occlusion. PMID: 20963849
Ezrin, HGF and C-met may have positive effects on the carcinogenesis of rat pancreas PMID: 21134835
VEGF and TGFbeta might modulate HGF signaling to influence route selection during cancer progression PMID: 21075102
HGF expression following sciatic nerve ligation was found decreased in ipsilateral dorsal root ganglions from day 3 to day 14. AND no significant change in HGF expression was detected in the lumbar spinal cords. PMID: 20814222
protective effects of GDNF and HGF on brain ischemia were associated with both antiapoptotic and antiautophagic effects; maybe two types of cell death can occur in the same cell at the same time, and GDNF and HGF are capable of ameliorating both pathways PMID: 20175208
HGF influences the metabolic activity of isolated Leydig cells (ie, uPA and MMP 2 secretion) and increases TGF-beta activity PMID: 19834131
HGF counteracted the effect of high glucose on protein kinase A and protein kinase G activity. Thus, inhibition of PKA and activation of PKG are involved in the antioxidant role of HGF. PMID: 20466058
Valsartan alleviates BLM-induced pulmonary fibrosis in rats, possibly by inhibiting the expression of TGF-beta and stimulating the expression of HGF in lung tissues. PMID: 16115399
HGF may play an important role in the early stages of dental pulp repair. PMID: 17294746
HGF-induced EPC proliferation is mediated partly via activation of STIM1 PMID: 20404049
HGF expression was significantly increased in control rats treated with Astragalus mongholicus compared to rats with unilateral ureteral obstruction. PMID: 19292056
Over-expression of HGF in vascular smooth muscle cells can be helpful for promoting endothelial stem cells differentiation, increasing their migration and proliferation PMID: 19095317
HGF is expressed in primary sensory neurons from dorsal root ganglia and spinal cord, and may be involved in sensory transmission. PMID: 11744165
Differential mitogenic effects of single chain hepatocyte growth factor (HGF)/scatter factor and HGF/NK1 following cleavage by factor Xa PMID: 11832492
results suggest that hepatocellular hypoxia causes inhibition of HGF-mediated proliferation PMID: 11839582

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.