Recombinant Rat IGFBP1 Protein

Name: Recombinant Rat IGFBP1 Protein
Brand: Beta LifeScience
SKU: BLA-1877P
Availability: InStock

Collections: Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Rat
Accession	P21743
Synonym	AFBP Alpha pregnancy associated endometrial globulin Amniotic fluid binding protein Binding protein 25 Binding protein 26 Binding protein 28 Growth hormone independent binding protein hIGFBP 1 hIGFBP1 IBP 1 IBP-1 IBP1 IBP1_HUMAN IGF binding protein 1 IGF BP25 IGF-binding protein 1 IGFBP 1 IGFBP-1 IGFBP1 Insulin like growth factor binding protein 1 Insulin-like growth factor-binding protein 1 Placental protein 12 PP 12 PP12
Description	Recombinant Rat IGFBP1 Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	APQPWHCAPCTAERLELCPPVPASCPEISRPAGCGCCPTCALPLGAACGV ATARCAQGLSCRALPGEPRPLHALTRGQGACVLEPAAPATSSLSGSQHEE AKAAVASEDELAESPEMTEEQLLDSFHLMAPSREDQPILWNAISTYSSMR AREITDLKKWKEPCQRELYKVLERLAAAQQKAGDEIYKFYLPNCNKNGFY HSKQCETSLDGEAGLCWCVYPWSGKKIPGSLETRGDPNCHQYFNVQN
Molecular Weight	27 kDa
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.
Subcellular Location	Secreted.
Database References	KEGG: rno:25685 STRING: 10116.ENSRNOP00000011338 UniGene: Rn.34026

Gene Functions References

In simulated sleep apnea hypopnea syndrome, intermittent hypoxia in young rats does not cause physical growth retardation, but serum IGF-1 and IGFBP-3 levels decreased with the increase of hypoxia and decline of oxygen saturation. PMID: 22805023
up-regulation of IGFBP-1 in oligodendrocytes in multiple sclerosis may serve two functions: (i) regulate IGF-1 actions, (ii) exert IGF-independent effects through its RGD sequence PMID: 20345750
Insulin regulation of insulin-like growth factor-binding protein-1 gene expression PMID: 11784721
regulation of expression by insulin is impaired by presence of hydrogen peroxide PMID: 11942857
IGFBP-1 and IGFBP-3 are present in phosphorylated form in fasted rat skin, which induced inhibition of collagen biosynthesis in cultured fibroblasts PMID: 12670795
IGFBP-1 released during the early steps of liver tissue damage and repair may interact with liver cells and potentiate the sensitivity of IGF-I to mitogenic signals. PMID: 15070850
In this report we demonstrate that in H4IIE-C3 cells, four distinct classes of GSK-3 inhibitor mimic the effect of insulin on a third thymine-rich insulin response element-containing gene, IGFBP-1. PMID: 15350195
Iron, radical oxygen species, and HIF-2 and -3 as well as prolyl hydroxylase pathways play important roles in mediating effects of hypoxia on IGFBP-1 gene expression in liver. PMID: 16166214
insulin inhibition of IGFBP-1 mRNA levels can occur in the absence of the phosphorylation of Foxo1/Foxo3, whereas activation of the mTOR pathway is both necessary and sufficient PMID: 16455781
Activation of the mTOR pathway, without activation of its upstream regulator PI 3-kinase, reduces IGFBP1 expression. PMID: 17032741
Age-related oxidative stress underlies the upregulated JNK activation and IGFBP-1 expression. PMID: 17645865

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.