Recombinant Rat Interferon Gamma (IFNG) Protein (GST)

Name: Recombinant Rat Interferon Gamma (IFNG) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-07951P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines, Cytokines and growth factors, Interferons and receptors (ifn), Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Interferon Gamma (IFNG) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P01581
Target Symbol	IFNG
Synonyms	IfngInterferon gamma; IFN-gamma
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Expression Range	23-156aa
Protein Length	Full Length of Mature Protein
Mol. Weight	42.5kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.
Subcellular Location	Secreted.
Protein Families	Type II (or gamma) interferon family
Database References	KEGG: rno:25712 STRING: 10116.ENSRNOP00000009917 UniGene: Rn.10795
Tissue Specificity	Released primarily from activated T lymphocytes.

Gene Functions References

Lipopolysaccharide enhances TLR4 expression in rat pulmonary artery smooth muscle cells and induced production of IFNgamma dramatically. PMID: 28714001
This study suggested that IFN-gamma maintained tolerance mediating alloantigen-specific CD4(+)CD25(+)T cells. PMID: 28487237
Addition of 20 (3) and 40 (6) mg/L (mg/kg BW) of boron to drinking water significantly increased rat serum IgG concentrations, splenic IFN-gamma and IL-4 expression as well as the number of splenic CD3(+), CD4(+) and proliferating cell nuclear antigen (PCNA)(+) cells. PMID: 28092075
The results provide evidence that changes in IFN-gamma expression and signalling may be perceived at stages preceding refractory cachexia, and therefore, might be employed as a means to assess the early stage of the syndrome PMID: 26987263
This study found that ACZ could decrease the content of pro-inflammatory cytokines, such as MCP-1, IL-1beta, TNF-alpha and IFN-gamma in rat lungs, and, the lung injury in the HA+ACZ group reduced. PMID: 27104804
IFN-gamma dose-dependently induces HMGB1 cytoplasmic accumulation and its active release from VSMCs, resulting in enhanced HMGB1 in the medium. PMID: 27579780
The results thus demonstrate that XO mediates oxidative stress in MB+PQ-treated rat PMNs via iNOS-independent but cytokine (predominantly IFN-gamma)-dependent mechanism. PMID: 28025796
Iba-1-immunoreactive microglia are activated and IFN-gamma and IL-1beta levels are increased in the hippocampal CA1 region and the dentate gyrus of aged, diabetic rats, indicating that chronic diabetes may accelerate aging processes in the hippocampus PMID: 24571083
The findings of the present study suggest that part of ischemic injury in the embolic stroke may be mediated through the increased levels of inflammatory cytokines. PMID: 24338258
Apoptotic cell death assessed by TUNEL assay was enhanced in both ERalpha and ERbeta-silenced VSC4.1 motoneurons following IFN-gamma and IGF-1 exposure. PMID: 24188094
The interleukin (IL)-18/IFN-gamma system may be involved in status epilepticus-induced vasogenic edema formation. PMID: 22338606
IFNgamma produced by constituents of the mucosal immune system modulates epithelial cell functions with relevance for intestinal wound healing and may play a role in preserving the integrity of the intestinal epithelium following various forms of injuries. PMID: 21385594
Furthermore, IFNgamma reduced JNK phosphorylation, which tightly was associated with decreased phosphorylation of downstream factors c-Jun and Smad3 and decreased binding activity of c-Jun and Smad3 in the preprpET-1 promoter. PMID: 22301113
Study provides mechanistic insights in the IFN-mediated suppression of ICP4 and IE180 in sensory neuronal cells. PMID: 21641126
Garlicin could increase the level of INF-gamma and decrease the level of IL4 significantly in allergic rhinitis. PMID: 18826099
IFN-gamma is able to activate rat intestinal mucous microvascular endothelial cells, thereby leading to upregulated expressions of IFN-alpha/beta. PMID: 20214528
IFN-gamma enhanced IL-27 secretion, revealing a cooperative interplay between the two cytokines. PMID: 21123181
Immunoregulatory cytokines belonging to the Th-1 group (IL-2 and IFN-gamma) were increased in the retina of experimental diabetic rats PMID: 20213480
The interplay between IFNgamma released from immune cells and PACAP is of importance in brain inflammation and may affect the regeneration and recruitment of NPCs in immune diseases PMID: 20559421
Fasting-induced iNOS activation in epithelial cells may induce apoptosis mediatiors such as interferon-gamma via a reactive oxyge speces-mediated mechanism. PMID: 20378828
Data show that IgG stimulation induced a significant TLR4 expression and TNF-alpha secretion in cultured microglial cells in a dose-dependent manner, while IFN-gamma was PMID: 19257980
Data show that treated rats exhibited the lowest degree of inflammatory infiltration of the spinal cord, as well as the lowest levels of nuclear factor kappa B, interleukin-12 and interferon-gamma. PMID: 19922500
Data show that methylprednisolone inhibited IFN-gamma and IL-17 expression and production in cells isolated from the CNS of rats with experimental autoimmune encephalomyelitis. PMID: 20003332
role of IFN-gamma in the regulation of bacterial load in the cecal ligation and puncture (CLP) model of intra-abdominal sepsis in the rat PMID: 11770039
Interferon-gamma significantly inhibits hepatic stellate cell proliferation and reduces smooth muscle alpha-actin abundance after 6 days treatment. PMID: 11940252
the spleen contributes to the endotoxin-induced liver injury by modulating release of IFNgamma PMID: 11954833
IFN-gamma increased mRNA activity and gene expression of TGase 2 in a rat small intestinal epithelial cell line. PMID: 12162878
IFN-gamma inhibited TGF-beta(1)-induced increases in PG expression by fibroblasts in fibrotic lungs. PMID: 12225958
Increased levels in BALF of anti-IP-10 antibody-treated F344 rats following Sendai viral infection. PMID: 12581489
role in post-translational regulation of Muc4 PMID: 12668667
plays an important physiological role during inflammation by down-regulating collagen gene expression and activating major histocompatibility II complex PMID: 12968017
Differential signaling through IFN-gamma in the conjunctiva between the Lewis and Brown Norway rat strains in experimental allergic conjunctivitis. This may be due to differences in histopathological character between the two strains. PMID: 14605445
The protein level of IFN-gamma follows a physiological circadian rhythm in rat splenocytes that concurrently drives the circadian rhythm of natural killer cell cytolytic activity. PMID: 14978081
IFN-gamma induces rapid secretion of macrophage migration inhibitory factor by renal tubular epithelial cells. PMID: 15012733
JNK signaling plays an important role in the inhibitory effects of cAMP on IL-1beta+IFNgamma-induced iNOS gene expression in cultured hepatocytes PMID: 15115662
Taken together, these results suggest that NDGA regulates IFN-gamma-mediated inflammation through mechanisms unrelated to the inhibition of 5-LO PMID: 15694390
retinoic acid induces an anti-inflammatory effect by suppressing the activation of the JAK/STAT pathway in IFN-gamma-treated astrocytes PMID: 15721283
IFN-gamma, in conjunction with TNF or LPS, can both inhibit hepatocyte proliferation through the generation of nitric oxide and stimulate oval cell replication. PMID: 15799032
Circadian expression of interferon gamma mRNA is demonstrated for the first time in natural killer (NK) cells enriched from rat spleen. PMID: 15944262
IFN-gamma can modulate the expression of RT1A and RT1-DM during the whole pregnancy PMID: 15946996
IFN-gamma in NK cells has a role in the link between the innate and adaptive immune responses early after transplantation PMID: 16095488
The leukemia inhibitory factor inhibition of interferon-gamma toxicity in oligodendrocytes is mediated by a suppressor of cytokine signaling-3 independent mechanism. PMID: 16289836
The evidence presented suggests that IGF-1 acts to antagonize the IFNgamma-induced microglial activation, the accompanying increase in IL-1beta concentration and the consequent deficit in LTP. PMID: 16464236
Intermittent fasting dietary restriction stimulates IFN-gamma-mediated neuroprotective signaling in the hippocampus, suggesting a role for this cytokine in neural cytoprotection. PMID: 16521127
Astrocytes up-regulated IFN-gamma gene expression and protein synthesis in T cells, which coincided with astrocytes' ability to express IL-23 subunit p19 and common IL-12/IL-23 subunit p40. PMID: 17969033
the primary effect of atorvastatin is to increase IL-4, which antagonizes the effects of IFNgamma, the associated increase in microglial activation, and the subsequent cascade of events. PMID: 17981803
Innate immunity (natural killer cells/IFN-gamma) is activated after allogeneic transplantation, which likely contributes to liver injury and inhibits hepatocyte proliferation. PMID: 18292182
Data suggest that estradiol effects on T cell IFN-gamma and IL-2 production afer trauma-hemorrhage are mediated via non-genomic pathway, and which is in turn mediated via ERK, p38, and JNK pathways. PMID: 18343154
The aim of this study was to evaluate the constitutive expression of IL-18 and its receptors (IL-18Ralpha and IL-18Rbeta) in intestinal epithelial cells (IEC) stimulated by tumor necrosis factor-alpha (TNF-alpha) and interferon-gamma (IFN-gamma). PMID: 18547159
An enhanced integrated stress response could promote oligodendrocyte survival in immune-mediated demyelination diseases. PMID: 18818381

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.