Recombinant Rat Interleukin-18 (IL18) Protein (His)

Name: Recombinant Rat Interleukin-18 (IL18) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08235P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Interleukins and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Interleukin-18 (IL18) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P97636
Target Symbol	IL18
Synonyms	Il18; Igif; Interleukin-18; IL-18; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
Expression Range	37-194aa
Protein Length	Full Length of Mature Protein
Mol. Weight	22.3kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	A proinflammatory cytokine primarily involved in polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells.
Subcellular Location	Cytoplasm. Secreted.
Protein Families	IL-1 family
Database References	KEGG: rno:29197 STRING: 10116.ENSRNOP00000013093 UniGene: Rn.11118

Gene Functions References

IL18 and the related markers were closely associated with the occurrence and development of deep venous thrombosis. PMID: 29786104
These observations suggest that IL-18 exerts direct effects upon the GnRH neuron via IL-18Ralpha and acts on GnRH neurons through an autocrine or paracrine pathway. PMID: 28373090
These findings also indicate that IL-18 is an important regulator leading to MMP-13 expression and cell migration in astrocytes. PMID: 26558633
These results suggest that the expression of interferon-gamma via IL-18 in the lenses of OVX rats is induced by ovariectomy PMID: 26725437
Excessive IL-18 Relate the Aggravation of Indomethacin-Induced Intestinal Ulcerogenic Lesions in Adjuvant-Induced Arthritis Rat PMID: 26424019
results provided evidence that delivery of IL-18 and IFN-beta by BMSCs may be an excellent and promising approach to develop an effective treatment protocol for glioma therapy. PMID: 26252165
PMA treatment during a vulnerable period can alter brain development. IL-18 and IRAK-4 appear to be important for the development of PMA induced injury. PMID: 25918710
Remifentanil protects the liver against I/R injury by modulating hepatic IL-18/IL-18BP balance and inhibiting IL-18 signaling PMID: 25919765
The results in vitro showed the protective effect of IL-18 on cortical neurons. PMID: 25022959
Using Dynamic Bayesian Network inference, we identified interleukin-18 as a central node associated with neuropathic pain in chronic sciatic constriction injury in rats. PMID: 26004155
IL-18 can augment the hepatocyte growth ability via NF-kappaB and p38/ATF2 by targeting cyclin B1, cyclin B2, cyclin A2 and Bcl-2 in BRL-3A rat liver cells. PMID: 25752290
IL-18 serves as a positive regulator of hepatocyte proliferation. PMID: 24412291
IL18 was significantly increased in rat benign prostatic hyperplasia tissue. PMID: 24615654
During learning, changes in IL-18 are restricted to the dorsal hippocampus. PMID: 23747799
Changes in macrophage IL-18 and vascular fibrinogen deopsition following injury in aging rats contribute to local inflammation and postinjury neointima formation. PMID: 24414074
interferon-gamma increases NF-kappaB and cytokine IL-18, but decreases IL-27 in acute pancreatitis PMID: 23725508
IFN-gamma production via IL-18 in the retinas of 60-week-old OLETF rats is caused by hyperglycemia, and plays a role in the inflammation of the OLETF rat retinas. PMID: 23823918
Chronic exposure of Sprague-Dawley rats to second hand smoke results in a significant increase of proinflammatory cytokine IL-18 in the bronchoalveolar lavage fluid. PMID: 23392573
IL-18 expression increases in brain following chronic neuroinflammation elicited by systemic inflammation. PMID: 22642744
Il-18-mediated up-regulation plays a role in maintenance of blood brain barrier function following status elepticus. PMID: 22338606
Our findings are the first report that injury of trigeminal nerve induced IL-18 upregulation in activated microglia in the Vc, suggesting a possible role of IL-18 in orofacial neuropathic pain. PMID: 23000553
Serum IL-18 level increased in the process of deep vein thrombosis. PMID: 22318348
Suggest that the angiotensin II/AT1/Nox1/IL-18 pathway is a critical factor in hyperplastic vascular diseases. PMID: 22636674
The treatment of rats with anti-IL-18 antibody at the time of burn injury prevented intestine apoptosis and normalized tight junction proteins following EtOH and burn injury. PMID: 22001439
differential expression in abortive rats as compared to of pregnant and non-pregnant rats PMID: 21920610
These results indicate that IL-18 secreted by microglia, which was activated by C6 glioma-derived ECM, enhanced migration of C6 glioma through NO/cGMP pathway. PMID: 21442623
IL-18 delays neutrophil apoptosis following EtOH and burn injury by modulating the pro- and antiapoptotic proteins. PMID: 20844839
Expression of IL-18, IL-6 and oxidative stress in rat peritoneal mesothelial cells stimulated by lipopolysaccharide PMID: 21882482
The expression of IL-18 was increased in the lenses of OLETF rat. It is possible that activated IL-18 in the lenses of OLETF rat may be related to the lens epithelial cell apotosis and lens opacification. PMID: 21591858
IL-18 may serve as an additional marker to monitor the severity of inflammation during pancreatitis. PMID: 21273803
Transcripts of core components of NOD-like receptor Nlrp6 inflammasome (Nlrp6, Pycard, Caspase-1) and one of its substrates, IL-18, were increased at E20 compared with E16 in fetal intestine and not lung. PMID: 21088234
chronic elevated IL-18 levels at a supraphsiological concentration aggravated insulin resistance, enhanced vascular inflammation and remodeling, probably by increasing the level of IRAK1 and the activity of NF-kappaB PMID: 19717152
Role in acute lung inflammation PMID: 11739527
Up-regulation of IL-18 and IL-12 in the ileum of neonatal rats with necrotizing enterocolitis. PMID: 12032269
IL-18 occured in the medial habenula (MHbS), the interpenducular nucleus, and in the ependymal cells surrounding the third and the lateral ventricles. Restraint stress induced a strong elevation of IL-18 in the MHbS but not in ependymal cells. PMID: 12468024
The frequent expression of IL-18 in thyrocytes suggests that IL-18 itself might be a secreted immunomodulator in autoimmune thyroid disease PMID: 12490070
Translational control of IL-18 expression by its 5'-UTR limits production of IL-18, resulting in restricted expression of mRNA and protein IFN-gamma in this model of crescentic glomerulonephritis(GN). Might amplify CD8+-mediated macrophage-dependent GN. PMID: 12787406
IL-18 induces CXCL16 expression via a MyD88, IRAK1-IRAK4-TRAF6, c-Src, PI3K, Akt, JNK, AP-1 pathway PMID: 15890643
IL-18 may have host-protective and growth-promoting functions in the testis. PMID: 16002206
The combined insult of EtOH and burn injury results in increased CORT levels, which in turn up-regulates intestinal IL-18 levels and thereby causes altered intestinal barrier function following a combined insult of EtOH intoxication and burn injury. PMID: 16707557
These results identify a critical role for IL-18 in neointimal formation in a rat model of vascular injury and suggest a potential role for IL-18 neutralization in the reduction of neointimal development. PMID: 16864728
mRNA and the protein level were attenuated by post hypoxia-ischemia hypothermia and that post hypoxia-ischemia hypothermia may decrease microglia activation in the developing brain. PMID: 17010950
Presence of neutrophils appears to be critical for IL-18-meditaed increased lung tissue edema following a combined insult of ethanol and burn injury. PMID: 17220368
IL-18 plays a role in enhancing the lipopolysaccharide-induced neutrophilic inflammation of the lung, but does not affect the resolution of inflammation. PMID: 17352829
IL-18 is regulated by parathyroid hormone and is required for its bone anabolic actions PMID: 18165223
Augmented IL-18 in serum and cardiac tissue in metabolic syndrome may contribute to the coronary perivascular fibrosis. PMID: 18504504
Rapamycin and Sanglifehrin A, but not Cyclosporin A, block IL-18 production and this novel Rapamycin blockade effect on IL-18 may contribute to the ability of Rapamycin to inhibit chronic allograft nephropathy and restenosis. PMID: 18662782
Our results indicate that IL-18-mediated microglia/astrocyte interactions in the spinal cord have a substantial role in the generation of tactile allodynia. PMID: 19036970
Neutrophil chemokines CINC-1/3 may have a role in IL-18-mediated increase in neutrophil O2- production and intestinal edema following alcohol intoxication and burn injury. PMID: 19497959

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.