Recombinant Rat Nadph Oxidase 4 (NOX4) Protein (His-B2M)

Name: Recombinant Rat Nadph Oxidase 4 (NOX4) Protein (His-B2M)
Brand: Beta LifeScience
SKU: BLC-08593P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Fc receptors, Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Nadph Oxidase 4 (NOX4) Protein (His-B2M) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q924V1
Target Symbol	NOX4
Synonyms	Nox4; Kox; NADPH oxidase 4; EC 1.6.3.-; Kidney oxidase-1; KOX-1; Kidney superoxide-producing NADPH oxidase
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His-B2M
Target Protein Sequence	GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
Expression Range	210-424aa
Protein Length	Extracellular Domain
Mol. Weight	38.6kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.
Subcellular Location	Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell junction, focal adhesion. Note=May localize to plasma membrane and focal adhesions.
Database References	KEGG: rno:85431 STRING: 10116.ENSRNOP00000018990 UniGene: Rn.14744
Tissue Specificity	Expressed in vascular smooth muscle.

Gene Functions References

chronic intermittent hypoxia-induced elevation of blood pressure is at least partially mediated via the Nox4-induced ROS/RhoA/ROCK pathway PMID: 28078487
This study, for the first time, demonstrates that Nox4 is an oxygen-sensing enzyme and a main ROS source in NP cells. Nox4-dependent ROS are genotoxic and a potent trigger of NP cell senescence. Nox4 is a potential therapeutic target for disc cell senescence and IDD. PMID: 29147462
The results demonstrate that the heightened sensitivity of the brain to ischemic damage is due to an organ-specific role of NOX4 in blood-brain barrier endothelial cells and neurons. PMID: 29087944
Results indicate that intermedin exerts anti-oxidant effects by inhibition of Nox4, and the effect can be mediated by cAMP-PKA pathway in unilateral ureteral obstruction induced renal fibrosis. PMID: 28805491
CYLD contributes to the transdifferentiation of adventitial fibroblasts via deubiquitinating Nox4 and may play a role in vascular remodeling. PMID: 28751569
Oxygen-glucose deprivation/reoxygenation increased MEG3 and NOX4 expression in rat brain microvascular endothelial cells. PMID: 28634073
increased mTAL luminal flow results in increases in intracellular and mitochondrial H2O2, which are dependent on the presence of Nox4, and that p67phox/Nox2 accounts solely for increases in O2 (.-) production PMID: 27279484
Xbp1s plays an important role in NOX4-triggered cardiomyocyte hypertrophy via activating its downstream effector RIPK1, which may prove significant for the development of future therapeutic strategies. PMID: 27929749
Nox4 activation in Vacular Smooth Muscle Cells contributes to actin depolymerization after hypoxia, which could be the underlying mechanism for myogenic tone impairment following ischemia/reperfusion. PMID: 27558234
Upregulation of Nox4 is an important mechanism of cellular and mitochondrial oxidative stress leading to apoptotic cell death in cardiac myocytes following chronic beta- agonist stimulation. PMID: 26631573
Luminal flow in thick ascending limbs leads to Nox4 recruitment to the nuclear region of thick ascending limb cells and an increase in O2 production. PMID: 27033446
Acute restraint stress exacerbates the contractile hyper-reactivity in diabetic carotid arteries by enhancing Nox4 functionality. PMID: 26387612
Hsp70 and CHIP mediates the ubiquitination and proteasomal degradation of Nox4 as part of the antioxidative effect of Losartan in spontaneous hypertensive rats. PMID: 26279425
the reduced renal injury and attenuated blood pressure response to high salt in the SS(Nox4-/-) rat could be the result of multiple pathways by the knock out of Nox4. PMID: 26644237
Glycated albumin increases the permissiveness of proximal tubular cells to fibrosis and apoptosis in vitro by triggering a pathway that involves Nox4. PMID: 25681565
Results suggest that Nox4-mediated reactive oxygen species generation likely plays important role in fate determination and differentiation of neural crest stem cells. PMID: 25410908
siNOX4 transfection markedly reduced rhBMP4-induced elevation of TRPC1 and 6 proteins. PMID: 25203114
this study demonstrated a previously unrecognized protective role of Nox4, a ROS-generating enzyme and the major Nox isoform in CMECs, against H/R injury by inhibiting apoptosis and promoting migration and angiogenesis PMID: 24480752
RhoA/ROCK is upstream of Poldip2-dependent Nox4 regulation and ROS production and induces redox signaling of kidney myofibroblast activation and may have broader implications in the pathophysiology of renal fibrosis. PMID: 24872317
Nox4 is prominently expressed in the adventitia and contributes to altered fibroblast behavior, hypertensive vascular remodeling, and development of pulmonary hypertension. PMID: 24947524
NOX4 activation is a decisive component in hepatic ischemia-reperfusion induced microcirculatory dysfunction. PMID: 24636100
hyperglycemia could increase albumin permeability across the podocyte filtration barrier via Nox4-dependent PKGIalpha dimerization PMID: 24041960
Data show that hypercholesterolemia affects myocardial microRNA expression, and by down-regulating microRNA-25 increases NOX4 expression and consequently oxidative/nitrative stress in the heart. PMID: 23722270
Atrial fibroblasts show greater fibrotic and oxidative responses to TGF-beta1 than ventricular fibroblasts and suggest role for Nox4. PMID: 23884197
Increased 8-OHdG concentration in the culture medium and higher expression of Nox-1, Nox-4, and p22(phox) mRNAs (3-6-fold) were observed in cells treated with AGE3. PMID: 23225244
these results indicate that IL-1beta-dependent activation of PKCdelta is modulated by NOX4-derived ROS. PMID: 23022406
the thyroid gland of females is exposed to higher oxidative stress levels due both to increased reactive oxygen species (ROS) production through NOX4, and decreased ROS degradation PMID: 23033809
Nox4D is a nuclear-localized and functionally active splice variant of Nox4 that may have important pathophysiologic effects through modulation of nuclear signaling and DNA damage in vascular cells. PMID: 23393389
Phenylephrine increased Nox4 protein expression and cardiomyocyte hypertrophy in a dose-dependent manner in cultured neonatal rat heart cells. PMID: 23271793
Telmisartan downregulates myocardial expression of Nox4 in type 2 diabetic rats. PMID: 22873349
NOX4 is the main catalytic isoform of NADPH oxidase that contributes to oxygen production in the thick ascending limb of kidney. PMID: 22875785
Study shows that testosterone induces vascular smooth muscle cells (VSMCs) migration via NADPH oxidase (Nox1 and Nox4 mRNA levels and p47phox)-derived reactive oxygen species (ROS) and c-Src-dependent pathways. PMID: 22566500
Abnormal expression of NADPH oxidase plays an important role in progression of hypertensive renal damage in spontaneously hypertensive rats. PMID: 21646815
In the aorta, Nox4 expression was increased by three-fold in obese rats. PMID: 22195989
This study provides strong evidence that Nox4 is an important source of reactive oxygen species (ROS) in the left ventricle and that Nox4-derived ROS contribute to cardiomyopathy at early stages of type 1 diabetes PMID: 22031600
Intracellular reactive oxygen species formation partly through an increasing NOX4 activity in response to high pacing frequency is associated with an increased atrial natriuretic peptide secretion. PMID: 22063193
IGF-I induces an increase in expression of Nox4 in cultured renal proximal tubular epithelial cells. PMID: 21940672
Expression of Nox4 was increased in vascular smooth muscle cells from SHR. Nox4,alone or in association,may be involved in NAD(P)H oxidase-mediated ROS production. PMID: 21419746
High NOX4 expression is associated with colon cancers. PMID: 20715105
Our results indicate that miR-25 as an endogenous gene silencing factor importantly contributes to the regulation of NOX4 gene expression in diabetic nephropathy. PMID: 21071935
Bilirubin and biliverdin protect rodents against diabetic nephropathy by downregulating NAD(P)H oxidase. PMID: 20686447
Upregulation of Nox4 by hypertrophic stimuli and aging induces oxidative stress, apoptosis and left ventricular dysfunction, via mitochondrial insufficiency caused by increased O(2)(-) production and cysteine oxidation in mitochondrial proteins. PMID: 20185797
Translocation of Hsp70 to proximal tubule membranes in SHRLos might exert a cytoprotective effect by down-regulation of NADPH subunits Nox4. PMID: 20016382
NADPH oxidase-derived reactive oxygen species is one of critical components of a signal transduction pathway that links puromycin aminonucleoside nephrosis to TRPC6-mediated Ca(2+) signaling. PMID: 19910702
Nox4-based NAD(P)H oxidase and generation of reactive oxygen species mediate the effect of ANG II on Akt/PKB activation and protein synthesis in glomerular mesangial cells PMID: 12842860
Nox4 co-localizes with vinculin in focal adhesions in vascular smooth muscle cells. Its role may be correlated with its compartmentalization in focal adhesions. PMID: 14670934
cardiac fibroblasts express Nox4/p22 phox-containing oxidant generating complex activated by H(2)O(2) PMID: 15848200
role for Nox4 as the major source of ROS in the kidneys during early stages of diabetes PMID: 16135519
Nox4-derived reactive oxygen species are critical to the maintenance of the differentiated phenotype of vascular smooth muscle cells. PMID: 17082491
blood pressure and angiotensin II type 1 receptor activation are involved in the up-regulation of Nox1 and Nox4 expression, which could contribute to vascular injury during chronic hypertension PMID: 17283869

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.