Recombinant Rat Oncostatin-M (OSM) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11215P

Greater than 85% as determined by SDS-PAGE.
Recombinant Rat Oncostatin-M (OSM) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11215P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Oncostatin-M (OSM) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q65Z15 |
Target Symbol | OSM |
Synonyms | Osm; Oncostatin-M; OSM |
Species | Rattus norvegicus (Rat) |
Expression System | E.coli |
Tag | N-10His |
Target Protein Sequence | KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR |
Expression Range | 26-208aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 26.2 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration. |
Subcellular Location | Secreted. |
Protein Families | LIF/OSM family |
Database References | |
Tissue Specificity | Widely expressed. Expressed at higher levels in liver, skin and spleen. |
Gene Functions References
- OSM is a key mediator for inducing differentiation of OC15-5 cells into hepatocytes PMID: 15743783
- In the immortalized mouse and primary cultured proliferative rat hepatocytes, treatment with OSM markedly increased mRNA and protein of claudin-2 together with formation of developed networks of TJ strands. PMID: 17434483
- OSM may not only play a role in the regulation of Sertoli cell proliferation and the initiation of spermatogenesis but may also play a role in the regulation of Leydig cell progenitor formation. PMID: 17996055
- Results indicate that osteosarcoma cells stably producing OSM do not develop resistance to this cytokine and thus could be a valuable new tool to study the anti-cancer effect of OSM in vivo. PMID: 19168167