Recombinant Rat PDGF AA Protein
Beta LifeScience
SKU/CAT #: BLA-1887P
Recombinant Rat PDGF AA Protein
Beta LifeScience
SKU/CAT #: BLA-1887P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P28576-2 |
Synonym | PDGF A PDGF A chain PDGF subunit A PDGF-1 PDGF1 PDGFA PDGFA_HUMAN Platelet derived growth factor alpha chain Platelet derived growth factor alpha isoform 2 preproprotein Platelet derived growth factor alpha polypeptide Platelet-derived growth factor A chain Platelet-derived growth factor alpha polypeptide Platelet-derived growth factor subunit A |
Description | Recombinant rat PDGF AA Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNT SSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLN PDHREEETDVR |
Molecular Weight | 25 kDa |
Purity | >98% SDS-PAGE.> 98 % by HPLC analysis. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 5.0 ng/mL, corresponding to a specific activity of > 2.0 x 105 IU/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |