Recombinant Rat Peroxiredoxin 2/PRP Protein
Beta LifeScience
SKU/CAT #: BLA-1888P
Recombinant Rat Peroxiredoxin 2/PRP Protein
Beta LifeScience
SKU/CAT #: BLA-1888P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P35704 |
Synonym | Epididymis secretory sperm binding protein Li 2a HEL S 2a MGC4104 Natural killer cell enhancing factor B Natural killer cell-enhancing factor B Natural Killer Enhancing Factor B NKEF B NKEF-B NKEFB Peroxiredoxin 2 Peroxiredoxin-2 PRDX 2 PRDX2 PRDX2_HUMAN PrP PRX2 PRXII PTX1 TDPX1 Thiol Specific Antioxidant 1 Thiol specific antioxidant protein Thiol-specific antioxidant protein Thioredoxin Dependent Peroxide Reductase 1 Thioredoxin peroxidase 1 Thioredoxin-dependent peroxide reductase 1 Torin TPX1 TSA |
Description | Recombinant Rat Peroxiredoxin 2/PRP Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMASGNAHIGKPAPDFTGTAVVDGAFK EIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVS VDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAY RGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGW KPGSDTIKPNVDDSKEYFSKHN |
Molecular Weight | 24 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle. |