Recombinant Rat Prolactin Receptor/PRL-R Protein
Beta LifeScience
SKU/CAT #: BLA-2017P
Recombinant Rat Prolactin Receptor/PRL-R Protein
Beta LifeScience
SKU/CAT #: BLA-2017P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P05710 |
Synonym | AI987712 CLONE SPM213 CPRLP Delta 4-delta 7/11 truncated prolactin receptor Delta 4-SF1b truncated prolactin receptor HPRL hPRL receptor hPRLrI Lactogen receptor MFAB MGC105486 OPR OTTHUMP00000115998 Pr-1 Pr-3 PRL R PRL-R PRLR Prlr-rs1 PRLR_HUMAN Prolactin receptor Prolactin receptor a Prolactin receptor delta 7/11 RATPRLR Secreted prolactin binding protein Truncated testis-specific box 1-C prolactin receptor wu:fj65c07 |
Description | Recombinant rat Prolactin Receptor/PRL-R Protein was expressed in Insect cells. It is a Protein fragment |
Source | Insect cells |
AA Sequence | SPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYEC PDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIV EPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPE EAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVE MPNDFTLKD |
Molecular Weight | 51 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | ED50 <50 ng/ml in the presence of 0.5 ng/ml of recombinant Human prolactin as determined in a cell proliferation assay using Nb2-11 rat lymphoma cells. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. |