Recombinant Rat Protransforming Growth Factor Alpha (TGFA) Protein (His-KSI)

Name: Recombinant Rat Protransforming Growth Factor Alpha (TGFA) Protein (His-KSI)
Brand: Beta LifeScience
SKU: BLC-07094P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Protransforming Growth Factor Alpha (TGFA) Protein (His-KSI) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P01134
Target Symbol	TGFA
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-6His-KSI
Target Protein Sequence	ENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV
Expression Range	24-159aa
Protein Length	Full Length of Mature Protein
Mol. Weight	30.1 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Subcellular Location	[Transforming growth factor alpha]: Secreted, extracellular space.; [Protransforming growth factor alpha]: Cell membrane; Single-pass type I membrane protein.
Database References	KEGG: rno:24827 STRING: 10116.ENSRNOP00000054248 UniGene: Rn.9952

Gene Functions References

5-HT stimulates DNA synthesis and proliferation in primary cultures of adult rat hepatocytes by acting via autocrine secretion of TGF-alpha induced by the serotonin 5-HT2B receptor/Gq/PLC/Ca2+ pathway. PMID: 26804134
Lipopolysaccharide exposure led to a suppression of both HDAC1 and HDAC2 expression and activity, induced TGFa expression, and disrupted alveolar morphology. PMID: 24595367
results support the hypothesis that FSH stimulates granulosa cell proliferation via theca TGFalpha secretion PMID: 12021046
A novel mechanism for mitogenic signaling via pro-transforming growth factor alpha within hepatocyte nuclei. PMID: 12029622
TGF-alpha exerts a neuroprotective action against NMDA toxicity, in which Erk1/2 activation plays a key role PMID: 12771152
TGF-alpha, laminin, and fibronectin are required for ovary follicle development and maturation PMID: 14656002
TGFalpha plays an autocrine role in LH dependent development and function of Leydig cells. PMID: 15353178
study adds TGFalpha to the list of dysregulated cytokines present in degrading cartilage in osteoarthritis PMID: 17968906
mechanical stretch promotes fetal type II cell differentiation via ectodomain shedding of HB-EGF and TGF-alpha PMID: 19237431
TGF-alpha has the ability to suppress anoikis of intestinal epithelial cells, at least in part, by reverting the loss of c-Src activity and Bcl-X(L) expression induced by detachment from the ECM. PMID: 11487584

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.