Recombinant Rat Sclerostin (SOST) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07680P
Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Sclerostin (SOST) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07680P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Sclerostin (SOST) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q99P67 |
Target Symbol | SOST |
Species | Rattus norvegicus (Rat) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY |
Expression Range | 29-213aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 24.9 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. |
Subcellular Location | Secreted. |
Protein Families | Sclerostin family |
Database References |
Gene Functions References
- alleviated the osteogenic differentiation of ectomesenchymal stem cells (EMSCs), and LNGFR enhanced the osteogenic differentiation of EMSCs by decreasing SOST PMID: 29226516
- TNF-alpha might mediate alveolar bone loss via inducing expression of osteocytic RANKL and sclerostin in type 1 diabetes rats with periodontitis PMID: 29240821
- These data suggest that sclerostin plays an important role in the bone remodeling of tooth movement. PMID: 28081119
- a direct correlation between attenuated SOST expression and an increase in the osteogenic potential of UMR-106 cells, is reported. PMID: 27233518
- In conclusion, naringin could prevent progress of disuse osteoporosis in rats, which may be mediated by increased periostin expression and subsequently inhibition of sclerostin and activation of Wnt/beta-catenin signaling pathways. PMID: 26541456
- Scl-Ab increased osteoblast surface and bone formation, indicating direct bone anabolic effects, whereas TE reduced osteoclast surface with minimal effect on bone formation, indicating antiresorptive effects PMID: 25359699
- Data indicate that sclerostin (SOST) gene expression is negatively regulated by histone deacetylase HDAC5 and positively by class I HDACs. PMID: 25012661
- The results suggest that Sost mRNA expression in metaphyseal bone responds to mechanical unloading in an opposite direction to that observed in diaphyseal cortical bone. PMID: 23337040
- Pharmacologic inhibition of sclerostin with Scl-Ab has no impact on articular cartilage remodeling in rats with posttraumatic osteoarthritis. PMID: 23233270
- Confocal immunofluorescence tiling imaging revealed the spatio-temporal distributions of osterix and sclerostin in femurs from 3-day-old, 2-week-old and 4-week-old rats to be reciprocally exclusive at the tissue level. PMID: 22766096
- The proportion of sclerostin-positive osteocytes in cortical bone was significantly higher. PMID: 22174402
- Insulin-deficiency in insulin-dependent diabetes mellitus decreases osteoblastogenesis associated with inhibition of Wnt signaling through the increased expression of Sost and Dkk1 and the inhibition of Akt activation. PMID: 21567076
- These results indicate that sclerostin inhibition by treatment with a sclerostin antibody increased bone formation, bone mass, and bone strength in aged male rats. PMID: 20641040
- SOST regulation may play a role in mediating PTH action in bone PMID: 15946907
- The anabolic effects of parathyroid hormone (PTH) are in line with the fall of SOST mRNA and protein in all the three bone segments examined; the rise of bone turnover supports a negative role of SOST in bone formation. PMID: 17549589
- SOST expression in osteocytes of adult bone and its inhibition by PTH is mediated by MEF2A, C, and D transcription factors controlling the SOST bone enhancer. PMID: 17696759
- Modulation of sclerostin levels appears to be a finely tuned mechanism by which osteocytes coordinate regional and local osteogenesis in response to increased mechanical stimulation, perhaps via releasing the local inhibition of Wnt/Lrp5 signaling PMID: 18089564