Recombinant Rat Sonic Hedgehog Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-1032P
Recombinant Rat Sonic Hedgehog Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-1032P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | Q63673 |
Synonym | HHG 1 HHG-1 HHG1 HLP 3 HLP3 Holoprosencephaly 3 HPE 3 HPE3 MCOPCB5 shh SHH_HUMAN SMMC I SMMCI Sonic Hedgehog (Drosophila) homolog Sonic hedgehog homolog sonic hedgehog homolog (Drosophila) Sonic hedgehog protein Sonic hedgehog protein C-product TPT TPTPS |
Description | Recombinant Rat Sonic Hedgehog Protein (Animal Free) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MIIGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSE RFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVK LRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFD WVYYESKARIHCSVKAENSVAAKSDG |
Molecular Weight | 20 kDa |
Purity | >95% SDS-PAGE.Produced using animal-free processes and contains only animal-free raw materials. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |