Recombinant Rat Sonic Hedgehog Protein
Beta LifeScience
SKU/CAT #: BLA-1031P
Recombinant Rat Sonic Hedgehog Protein
Beta LifeScience
SKU/CAT #: BLA-1031P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | Q63673 |
Synonym | HHG 1 HHG-1 HHG1 HLP 3 HLP3 Holoprosencephaly 3 HPE 3 HPE3 MCOPCB5 shh SHH_HUMAN SMMC I SMMCI Sonic Hedgehog (Drosophila) homolog Sonic hedgehog homolog sonic hedgehog homolog (Drosophila) Sonic hedgehog protein Sonic hedgehog protein C-product TPT TPTPS |
Description | Recombinant Rat Sonic Hedgehog Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MIIGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSE RFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVK LRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFD WVYYESKARIHCSVKAENSVAAKSDG |
Molecular Weight | 20 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |