Recombinant Rat Tgf-Beta Receptor Type-2 (TGFBR2) Protein (His&Myc)

Name: Recombinant Rat Tgf-Beta Receptor Type-2 (TGFBR2) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-07903P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Tgf-Beta Receptor Type-2 (TGFBR2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P38438
Target Symbol	TGFBR2
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ
Expression Range	24-166aa
Protein Length	Partial
Mol. Weight	21.0 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Membrane raft.
Protein Families	Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Database References	KEGG: rno:81810 STRING: 10116.ENSRNOP00000035501 UniGene: Rn.164421

Gene Functions References

Findings outlined in the current study demonstrated that 1,25(OH)2D3 was a promising therapeutic modality for treatment of Pulmonary arterial hypertension, function of which was exerted through miR-204 mediated Tgfbr2 signaling. PMID: 29196166
Blocking Hsp90-Cdc37 interactions during pressure overload hypertrophy results in ubiquitin-mediated proteasomal degradation of TGFBR2 leading to termination of TGF beta mediated signaling. PMID: 26362850
The levels of collagen I and alpha-SMA were downregulated in CS/S58 gel-treated eyes. Conjunctival fibroblast proliferation and the inflammation response were also suppressed in the CS/S58 gel-treated group. PMID: 26284552
Morphological and biochemical data about the endosomal compartments involved in the internalization of TbetaRII upon inflammatory stimuli are shown. PMID: 25813266
We proved that miRNA-337 is associated with chondrogenesis through regulating TGFBR2 expression, and miRNA-337 can also influence cartilage-specific gene expression in chondrocytes. PMID: 22425884
the increased dimerization of TbetaRII in hypertrophic cardiomyocytes comparing to the normal cardiomyocytes was found. PMID: 21382347
These data indicated that knockdown of TGFbetaRII expression inhibited the activation of hepatic stellate cells and the production of fibrogenic extracellular matrix components in HSC-T6 cells. PMID: 21378033
Dragon's Blood can effectively reduce pulmonary fibrosis by inhibiting the expression of TGFbetaR II mRNA in the lung tissue. PMID: 17953362
Differential expression of TGF-beta type I and II receptors by pulmonary cells in bleomycin-induced lung injury correlate with repair and fibrosis, with reduced Tgfbr2 expression occurring during the later (days 14-28 )decreased cell proliferation stage. PMID: 11936776
TGFBRII expression is induced by acetaldehyde, a major active metabolite of alcohol PMID: 12223100
Tgfbr2 had a marked yet transient upregulation in glomerular cells in experimental glomerulonephritis. PMID: 12545247
detection of TGFbetas, TbetaRII expression and telomerase activity in hyperplastic, dysplastic cholangiocytes, cholangiocarcinoma cells as well as in stroma fibroblasts during cholangiocarcinogenesis PMID: 12632524
albumin-induced internalization of TbetaRII signaling may be an important mechanism in the vessel wall for controlling TGF-beta responses in endothelial cells PMID: 14729511
The decreased expression of TGF-beta1 mRNA in the hypoplastic heart suggests that the downregulation of RAS may be involved in the pathogenesis of cardiac hypoplasia in nitrofen-induced CDH. PMID: 15578192
Maximal content of TGFbetaRII has been observed immunohistochemically in the early stage of pancreatic regeneration following ischemia/reperfusion-induced acute pancreatitis, suggesting the involvement of this growth factor in pancreatic recovery. PMID: 15613744
Pituitary cells, which demonstrate reduced expression of dopamine beta2 receptor, also show reduction of TGFbeta1 type II receptor. PMID: 15961557
Connective tissue growth factor, which is induced by TGFbeta, is expressed only iin heart transplantations with chronic rejection. PMID: 16611331
Transforming growth factor beta receptor 2 were obviously expressed in primitive pulmonary alveolus, showing it plays an important regulatory role in the development of rat embryo and embryonic lung, especially in organic morphodifferentiation. PMID: 17428384
transforming growth factor-beta receptor II promoter is methylated by lentivirus-mediated shRNA delivery PMID: 17533113
Tgfbr2 was methylated and markedly down-regulated in three of seven 3,2'-dimethyl-4-aminobiphenyl-induced invasive adenocarcinomas in the dorsolateral lobe of the rat prostate. PMID: 18381416

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.