Recombinant Rat TNF alpha Protein
Beta LifeScience
SKU/CAT #: BLA-1034P
Recombinant Rat TNF alpha Protein
Beta LifeScience
SKU/CAT #: BLA-1034P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rat |
Accession | P16599 |
Synonym | APC1 APC1 protein Cachectin DIF Differentiation inducing factor Macrophage cytotoxic factor Tnf TNF superfamily member 2 TNF superfamily, member 2 TNF, macrophage derived TNF, monocyte derived TNF-a TNF-alpha TNFA TNFA_HUMAN TNFSF2 Tumor necrosis factor Tumor necrosis factor (TNF superfamily member 2) Tumor necrosis factor alpha Tumor necrosis factor ligand superfamily member 2 Tumor Necrosis Factor, Membrane Form Tumor necrosis factor, soluble form |
Description | Recombinant Rat TNF alpha Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMLRSSSQNSSDKPVAHVVANHQAEEQ LEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLL THTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQL EKGDLLSAEVNLPKYLDITESGQVYFGVIAL |
Molecular Weight | 20 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |