Recombinant Rat Uteroglobin Protein

Name: Recombinant Rat Uteroglobin Protein
Brand: Beta LifeScience
SKU: BLA-1038P
Availability: InStock

Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Rat
Accession	P17559
Synonym	Blastokinin CC10 CC16 CCPBP CCSP Clara cell phospholipid binding protein Clara cell phospholipid-binding protein Clara cell specific 10 kD protein Clara cells 10 kDa secretory protein OTTHUMP00000236107 SCGB1A1 Secretoglobin family 1A member 1 Secretoglobin, family 1A, member 1 (uteroglobin) UG UGB UP-1 UP1 Urinary protein 1 Urine protein 1 UTER_HUMAN Uteroglobin
Description	Recombinant rat Uteroglobin Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTL PQETRINIVKLTEKILTSPLCEQDLRV
Molecular Weight	17 kDa
Purity	>97% SDS-PAGE.> 97 % by HPLC.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of >200 IU/m.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
Subcellular Location	Secreted.
Protein Families	Secretoglobin family
Database References	KEGG: rno:25575 STRING: 10116.ENSRNOP00000027342 UniGene: Rn.2206
Tissue Specificity	Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways).

Gene Functions References

The expression level of CC16 in lung tissues and BALF decreased in rat lung tissues exposed to mixed air pollutants. PMID: 18303626
IL-13 induces CCSP expression via an EGFR- and leukocyte-dependent pathway. PMID: 12060562
Results show that secretory markers such as CFTR, CC10, and CC26 are present in taste cells of rat circumvallate papillae, and their immunoreactivity is expressed, to a different extent, in subsets of taste cells that express alpha-gustducin. PMID: 18156603

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.