Recombinant rhesus monkey CD40 Protein (Fc Tag)

Name: Recombinant rhesus monkey CD40 Protein (Fc Tag)
Brand: Beta LifeScience
SKU: BLA-10761P
Availability: InStock

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Co-stimulatory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, Immune checkpoint proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Rhesus monkey
Accession	H9ZFM8
Synonym	AI326936 B cell associated molecule CD40 B cell surface antigen CD40 B cell-associated molecule B-cell surface antigen CD40 Bp50 CD 40 CD40 CD40 antigen CD40 antigen (TNF receptor superfamily member 5) CD40 molecule CD40 molecule, TNF receptor superfamily member 5 CD40 protein CD40 type II isoform CD40L receptor CDw40 GP39 HIGM1 IGM IMD3 MGC9013 Nerve growth factor receptor related B lymphocyte activation molecule OTTHUMP00000031699 OTTHUMP00000031700 p50 T-BAM TBAM TNF receptor superfamily member 5 TNFRSF5 TNR5_HUMAN TRAP Tumor necrosis factor receptor superfamily , member 5 Tumor necrosis factor receptor superfamily member 5 Tumor necrosis factor receptor superfamily member 5 precursor Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a
Description	Recombinant rhesus monkey CD40 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment
Source	HEK293
AA Sequence	EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDT WNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCMSESCESCV PHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETK DLVVQQAGTNKTDVVCGPQDRQR
Molecular Weight	46 kDa including tags
Purity	>95% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized the recombinant protein at 2μg/mL (100 µl/well), can bind Recombinant Human CD40LG /CD40 Ligand Protein with a linear of 5-50 ng/mL.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -80°C.

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.