Recombinant Rhesus monkey CD86 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11154P
Recombinant Rhesus monkey CD86 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11154P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rhesus monkey |
Accession | H9ZFI8 |
Synonym | Activation B7-2 antigen Activation B7-2 antigen 3 B-lymphocyte activation antigen B7-2 B-lymphocyte activation antigen B7-2 2 B7 B7 2 B7-2 B7.2 B70 B72 B72 antigen BU63 CD28 antigen ligand 2 CD28 antigen ligand 2 2 Cd28l2 CD28LG2 CD86 CD86 antigen CD86 antigen (CD28 antigen ligand 2 B7 2 antigen) CD86 antigen (CD28 antigen ligand 2, B7-2 antigen) CD86 antigen (CD28 antigen ligand 2, B7-2 antigen) 1, 2 CD86 molecule CD86_HUMAN CLS1 CTLA-4 counter-receptor B7.2 CTLA-4 counter-receptor B7.2 2 CTLA-4 counter-receptor B7.2 2, 3 Early T-cell costimulatory molecule 1 ETC-1 FUN 1 FUN-1 FUN1 LAB72 Ly-58 Ly58 MB7 MB7-2 Membrane glycoprotein MGC34413 T lymphocyte activation antigen CD86 precursor T-lymphocyte activation antigen CD86 TS/A-2 |
Description | Recombinant Rhesus monkey CD86 Protein (His tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | YFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKEKFDSVHS KYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRIHQMNSEL SVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTI EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSS PFSIELEDPQPPPDHIPHHHHHH |
Molecular Weight | 26 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |