Recombinant Rhesus monkey EpCAM Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8317P

Recombinant Rhesus monkey EpCAM Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8317P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Rhesus monkey
Accession Q1WER1
Synonym 17 1A 323/A3 Adenocarcinoma associated antigen Adenocarcinoma-associated antigen Antigen identified by monoclonal antibody AUA1 AUA1 CD326 CD326 antigen Cell surface glycoprotein Trop 1 Cell surface glycoprotein Trop 2 Cell surface glycoprotein Trop-1 CO 17A CO17 1A CO17A DIAR5 EGP EGP 2 EGP2 EGP314 EGP40 Ep CAM Ep-CAM EPCAM EPCAM_HUMAN EpCAM1 Epithelial cell adhesion molecule Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD) Epithelial cell surface antigen Epithelial cellular adhesion molecule Epithelial glycoprotein Epithelial glycoprotein 1 Epithelial glycoprotein 314 ESA GA733 1 GA733 2 GA733-2 gastrointestinal tumor-associated antigen 2, 35-KD glycoprotein gp4 hEGP 2 hEGP314 HNPCC8 Human epithelial glycoprotein 2 KS 1/4 antigen KS1/4 KSA Ly74 Lymphocyte antigen 74 M1S 1 M1S2 M4S1 Major gastrointestinal tumor associated protein GA733 2 Major gastrointestinal tumor-associated protein GA733-2 mEGP314 Membrane component chromosome 4 surface marker (35kD glycoprotein) Membrane component, chromosome 4, surface marker Membrane component, chromosome 4, surface marker 1 MIC18 MK 1 Protein 289A TACD1 TACSTD1 TROP1 Tumor associated calcium signal transducer 1 Tumor associated calcium signal transducer 2 precursor Tumor-associated calcium signal transducer 1
Description Recombinant Rhesus monkey EpCAM Protein (His tag) was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence QKECVCENYKLAVNCFLNDNGQCQCTSIGAQNTVLCSKLAAKCLVMKAEM NGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAG VRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDVQSLRTALEEAIKTR YQLDPKFITNILYEDNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGE SLFHSKKMDLRVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Molecular Weight 28 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed