Recombinant rhesus monkey GM-CSF Protein
Beta LifeScience
SKU/CAT #: BLA-1916P
Recombinant rhesus monkey GM-CSF Protein
Beta LifeScience
SKU/CAT #: BLA-1916P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rhesus monkey |
Accession | Q9GL44 |
Synonym | Colony stimulating factor Colony Stimulating Factor 2 Colony stimulating factor 2 (granulocyte-macrophage) Colony-stimulating factor CSF CSF 2 CSF2 CSF2_HUMAN GM-CSF GMCSF Granulocyte Macrophage Colony Stimulating Factor Granulocyte-macrophage colony-stimulating factor MGC131935 MGC138897 MGI1GM Molgramostin Pluripoietin-a Sargramostim |
Description | Recombinant rhesus monkey GM-CSF Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | APARSPSPGTQPWEHVNAIQEARRLLNLSRDTAAEMNKTVEVVSEMFDLQ EPSCLQTRLELYKQGLQGSLTKLKGPLTMMASHYKQHCPPTPETSCATQI ITFQSFKENLKDFLLVIPFDCWEPVQE |
Molecular Weight | 14 kDa |
Purity | >98% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. The ED50ascalculated by the dose-dependant stimulation of the proliferation ofHuman TF-1 cells is less than 0.1 ng/ml, corresponding to a Specific Activityof 1.0x107IU/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Please see notes section. |