Recombinant rhesus monkey Interferon gamma Protein

Name: Recombinant rhesus monkey Interferon gamma Protein
Brand: Beta LifeScience
SKU: BLA-1057P
Availability: InStock

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines and growth factors, Other cytokines, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Rhesus monkey
Accession	P63310
Synonym	IF 1 IFG IFI IFN gamma IFN immune IFN, immune IFN-gamma IFNG IFNG_HUMAN Immune interferon Interferon gamma Type II Interferon
Description	Recombinant rhesus monkey Interferon gamma Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIV SFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSV TDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Molecular Weight	17 kDa
Purity	>97% SDS-PAGE.>97% as determined by SDS-PAGE and HPLC.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using HeLa cells infected with encephalomyocarditis (EMC) virus is less than 20.0 ng/ml, corresponding to a specific activity of >5.0 x 104 IU/mg.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.
Subcellular Location	Secreted.
Protein Families	Type II (or gamma) interferon family
Database References	KEGG: mcc:574282 STRING: 9544.ENSMMUP00000025266 UniGene: Mmu.3373
Tissue Specificity	Released primarily from activated T lymphocytes.

Gene Functions References

IFNgamma expression in colonic epithelial cells was regulated by TGFB1. PMID: 25769244
Higher KIR2DL4 copy numbers is associated with an increased IFN-gamma production in NK cell subsets in SIV-infected Mamu-A*01-negative rhesus macaques. PMID: 23449795
Data show that viral set-point in simian immunodeficiency virus diseasewas is associated with expression of interferon gamma -stimulated genes. PMID: 17719201
Low Sociable animals showed alterations in lymph node expression of the immunoregulatory cytokine interferon-gamma. PMID: 18068331

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.