Recombinant Rhesus monkey TFPI Protein
Beta LifeScience
SKU/CAT #: BLA-10386P
Recombinant Rhesus monkey TFPI Protein
Beta LifeScience
SKU/CAT #: BLA-10386P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rhesus monkey |
Accession | Q28864 |
Synonym | Anti convertin EPI Extrinsic pathway inhibitor LACI Lipoprotein associated coagulation inhibitor Lipoprotein-associated coagulation inhibitor TFI TFPI TFPI 1 TFPI1 TFPI1_HUMAN Tissue factor pathway inhibitor Tissue factor pathway inhibitor (lipoprotein associated coagulation inhibitor) |
Description | Recombinant Rhesus monkey TFPI Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | DSEEDEEYTIITDTELPPLKLMHSFCAFKPDDGPCKAIMKRFFFNIFTRQ CEEFIYGGCGGNQNRFESMEECKKVCTRDNVHRIIQTALQQEKPDFCFLE EDPGICRGYITRYFYNNQSKQCERFKYGGCLGNMNNFETLEECKNTCEDG LNGFQVDNYGTQLNAVNNSQTPQSTKVPSFFEFHGPSWCLAPADRGLCRA NENRFYYNSVIGKCRPFKYSGCGGNENNFTSKRECLRACKKGFIQRISKG GLIK |
Molecular Weight | 31 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |