Recombinant rhesus monkey TNF alpha Protein

Name: Recombinant rhesus monkey TNF alpha Protein
Brand: Beta LifeScience
SKU: BLA-1059P
Availability: InStock

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines and growth factors, Recombinant proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Rhesus monkey
Accession	P48094
Synonym	APC1 APC1 protein Cachectin DIF Differentiation inducing factor Macrophage cytotoxic factor Tnf TNF superfamily member 2 TNF superfamily, member 2 TNF, macrophage derived TNF, monocyte derived TNF-a TNF-alpha TNFA TNFA_HUMAN TNFSF2 Tumor necrosis factor Tumor necrosis factor (TNF superfamily member 2) Tumor necrosis factor alpha Tumor necrosis factor ligand superfamily member 2 Tumor Necrosis Factor, Membrane Form Tumor necrosis factor, soluble form
Description	Recombinant rhesus monkey TNF alpha Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELTDNQLVV PSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSP CQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQV YFGIIAL
Purity	>95% SDS-PAGE.>95% by HPLC.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.05 ng/ml, corresponding to a specific activity of >2.0x107 IU/mg in the presence of actinomycin D.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Subcellular Location	Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.
Protein Families	Tumor necrosis factor family
Database References	KEGG: mcc:715467 STRING: 9544.ENSMMUP00000011594 UniGene: Mmu.3364

Gene Functions References

These interactions result in the induction of the TNF signaling pathway, activation of apoptosis, and DNA-damage stress response. PMID: 24743303
Findings showed that both mucosal compartments harbor similar percentages of memory CD4(+) T cells and displayed comparable cytokine TNF-alpha responses to mitogenic stimulations prior to infection. PMID: 24610016
Primary role for IL-1beta and TNF-alpha in the triggering of preterm labor associated with inflammation or infection. PMID: 17132473

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.