Recombinant Sheep Growth/Differentiation Factor 9 (GDF9) Protein (His&Myc)

Name: Recombinant Sheep Growth/Differentiation Factor 9 (GDF9) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-00169P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Sheep Growth/Differentiation Factor 9 (GDF9) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	O77681
Target Symbol	GDF9
Synonyms	(GDF-9)
Species	Ovis aries (Sheep)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR
Expression Range	319-453aa
Protein Length	Full Length of Mature Protein
Mol. Weight	22.9 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Required for ovarian folliculogenesis.
Subcellular Location	Secreted.
Protein Families	TGF-beta family
Database References	KEGG: oas:100217402 UniGene: Oar.12657

Gene Functions References

The detection and identification of single nucleotide polymorphisms in exon 2 of GDF9 gene in Kermani sheep breed using PCR-SSCP are reported. PMID: 27487501
c.978A>G and c.994G>A SNPs are genetic markers for fecundity in Araucana creole sheep PMID: 27110683
study concluded that growth differentiation factor 9 and bone morphogenic protein 15 follow stage-specific pattern of expression during the in vivo development of ovarian follicles in sheep, and in vitro culture altered these changes PMID: 26474685
Analysis of data on Belclare sheep revealed a significant association between V371M mutation og GDF9 and ovulation rate. PMID: 24751660
The Lleyn breed was the most likely source of the BMP15 FecX(G) and GDF9 FecG(H) mutations in Belclare and Cambridge sheep, and the BMP15 FecX(B) mutation came from the High Fertility line developed from prolific ewes in commercial flocks in Ireland. PMID: 23301039
GDF9 genotypes did not have any significant effect on reproduction traits in Mehraban ewes. PMID: 23583795
We have identified a missense mutation in the bioactive part of the GDF9 protein that shows strong association with litter size in NWS. PMID: 23280002
These results preliminarily indicated that allele D of GDF9 gene was a potential genetic marker for improving litter size in Small Tail Han sheep. PMID: 21184179
Homozygosity for a single base-pair mutation in the oocyte-specific GDF9 gene results in sterility in Thoka sheep. PMID: 19713444
11-point mutations of BMP1B, BMP15, and GDF9 genes of 97 Bonpala ewes were genotyped. PMID: 21774623
A significant association was found between GDF9 gene HhaI polymorphism and litter size in fat-tailed sheep. The heterozygous genotype showed higher litter size. PMID: 21327517
Study found a new allele of GDF9, named FecG, which leads to an amino acid substitution in a conserved position; homozygote ewes presenting the FecG(E) allele have shown an increase in their ovulation rate (82%) and prolificacy (58%). PMID: 20528846
These heterozygous genotypes resulted in higher ovulation rates, illustrating that one copy of each of the BMP15 and GDF9 mutations had equivalent effects on the ovulation rate. PMID: 19144040
The findings of this study point to a preliminary supposition that mutations of both the FecB locus of BMPR1B gene and G1 locus of GDF9 gene might be major determinant to influence prolificacy in the Garole sheep. PMID: 20020203
Sequence of the complete coding region of GDF9 gene and determination of the patterns of expression of mRNAs encoding GDF9. PMID: 17715428
Expression patterns of 4 maternal effect genes (ZAR1, MATER, GDF9, and BMP15) were determined in ovine oocytes and in vitro-produced preimplantation embryos. PMID: 19007555

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.