Recombinant Sheep Growth/Differentiation Factor 9 (GDF9) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00169P

Greater than 90% as determined by SDS-PAGE.
Recombinant Sheep Growth/Differentiation Factor 9 (GDF9) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00169P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Sheep Growth/Differentiation Factor 9 (GDF9) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Activity | Not tested. |
Uniprotkb | O77681 |
Target Symbol | GDF9 |
Synonyms | (GDF-9) |
Species | Ovis aries (Sheep) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR |
Expression Range | 319-453aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 22.9 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Required for ovarian folliculogenesis. |
Subcellular Location | Secreted. |
Protein Families | TGF-beta family |
Database References | KEGG: oas:100217402 UniGene: Oar.12657 |
Gene Functions References
- The detection and identification of single nucleotide polymorphisms in exon 2 of GDF9 gene in Kermani sheep breed using PCR-SSCP are reported. PMID: 27487501
- c.978A>G and c.994G>A SNPs are genetic markers for fecundity in Araucana creole sheep PMID: 27110683
- study concluded that growth differentiation factor 9 and bone morphogenic protein 15 follow stage-specific pattern of expression during the in vivo development of ovarian follicles in sheep, and in vitro culture altered these changes PMID: 26474685
- Analysis of data on Belclare sheep revealed a significant association between V371M mutation og GDF9 and ovulation rate. PMID: 24751660
- The Lleyn breed was the most likely source of the BMP15 FecX(G) and GDF9 FecG(H) mutations in Belclare and Cambridge sheep, and the BMP15 FecX(B) mutation came from the High Fertility line developed from prolific ewes in commercial flocks in Ireland. PMID: 23301039
- GDF9 genotypes did not have any significant effect on reproduction traits in Mehraban ewes. PMID: 23583795
- We have identified a missense mutation in the bioactive part of the GDF9 protein that shows strong association with litter size in NWS. PMID: 23280002
- These results preliminarily indicated that allele D of GDF9 gene was a potential genetic marker for improving litter size in Small Tail Han sheep. PMID: 21184179
- Homozygosity for a single base-pair mutation in the oocyte-specific GDF9 gene results in sterility in Thoka sheep. PMID: 19713444
- 11-point mutations of BMP1B, BMP15, and GDF9 genes of 97 Bonpala ewes were genotyped. PMID: 21774623
- A significant association was found between GDF9 gene HhaI polymorphism and litter size in fat-tailed sheep. The heterozygous genotype showed higher litter size. PMID: 21327517
- Study found a new allele of GDF9, named FecG, which leads to an amino acid substitution in a conserved position; homozygote ewes presenting the FecG(E) allele have shown an increase in their ovulation rate (82%) and prolificacy (58%). PMID: 20528846
- These heterozygous genotypes resulted in higher ovulation rates, illustrating that one copy of each of the BMP15 and GDF9 mutations had equivalent effects on the ovulation rate. PMID: 19144040
- The findings of this study point to a preliminary supposition that mutations of both the FecB locus of BMPR1B gene and G1 locus of GDF9 gene might be major determinant to influence prolificacy in the Garole sheep. PMID: 20020203
- Sequence of the complete coding region of GDF9 gene and determination of the patterns of expression of mRNAs encoding GDF9. PMID: 17715428
- Expression patterns of 4 maternal effect genes (ZAR1, MATER, GDF9, and BMP15) were determined in ovine oocytes and in vitro-produced preimplantation embryos. PMID: 19007555