Recombinant Tobacco Osmotin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1923P
Recombinant Tobacco Osmotin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1923P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Tobacco |
Accession | P14170 |
Synonym | AP24 |
Description | Recombinant Tobacco Osmotin Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ATIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVINAPRGTKMARVWGRTN CNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSGLDFWDISL VDGFNIPMTFAPTNPSGGKCHAIHCTANINGECPRELRVPGGCNNPCTTF GGQQYCCTQGPCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYR VIFCPNGQAHPNFPLEMPGSDEVAK |
Molecular Weight | 40 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Subcellular Location | Vacuole. Note=Vacuolar inclusion body. |
Protein Families | Thaumatin family |
Database References | KEGG: nta:107787819 UniGene: Nta.2852 |
Tissue Specificity | Highly expressed in roots and flower buds. |