Recombinant Turkey IGF1 Protein
Beta LifeScience
SKU/CAT #: BLA-1925P
Recombinant Turkey IGF1 Protein
Beta LifeScience
SKU/CAT #: BLA-1925P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Turkey |
Accession | O93380 |
Synonym | IBP1 IGF I IGF IA IGF IB IGF-I Igf1 IGF1_HUMAN IGF1A IGFI IGFIA Insulin like growth factor 1 Insulin like growth factor 1 (somatomedin C) Insulin like growth factor IA Insulin like growth factor IB Insulin-like growth factor I Mechano growth factor MGF OTTHUMP00000195080 OTTHUMP00000195081 OTTHUMP00000195082 OTTHUMP00000195083 OTTHUMP00000195084 Somatomedia C Somatomedin C Somatomedin-C |
Description | Recombinant Turkey IGF1 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQ SCDLRRLEMYCAPIKPPKSA |
Molecular Weight | 8 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |