Recombinant Woodchuck Interferon gamma Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1074P
Recombinant Woodchuck Interferon gamma Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1074P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Woodchuck |
Accession | O35735 |
Synonym | IF 1 IFG IFI IFN gamma IFN immune IFN, immune IFN-gamma IFNG IFNG_HUMAN Immune interferon Interferon gamma Type II Interferon |
Description | Recombinant Woodchuck Interferon gamma Protein (His tag) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIV SFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQV NDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK |
Molecular Weight | 19 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. |
Subcellular Location | Secreted. |
Protein Families | Type II (or gamma) interferon family |
Tissue Specificity | Released primarily from activated T lymphocytes. |