Recombinant Zebrafish Interferon gamma Protein
Beta LifeScience
SKU/CAT #: BLA-1078P
Recombinant Zebrafish Interferon gamma Protein
Beta LifeScience
SKU/CAT #: BLA-1078P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Zebrafish |
Accession | Q5TLE6 |
Synonym | IF 1 IFG IFI IFN gamma IFN immune IFN, immune IFN-gamma IFNG IFNG_HUMAN Immune interferon Interferon gamma Type II Interferon |
Description | Recombinant Zebrafish Interferon gamma Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | YRFRRSRSENPILNTNIEKLKTHYNTLAKDWVGKSVFVSHLDQLNSKPTC TCQAVLLEGMLSIYEDIFQDMMNKSDNKEVRDDLKKVIHEVKNLKHKYNE EHKLWRELQDIHSVKAKNGTIQERALNDFLKVYYRASTEKRHLHMS |
Molecular Weight | 17 kDa |
Purity | >95% SDS-PAGE.Purified by ion-exchange chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle. |