Recombinant Zebrafish TNF superfamily member 2 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1079P
Recombinant Zebrafish TNF superfamily member 2 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1079P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Zebrafish |
Accession | Q4W898 |
Description | Recombinant Zebrafish TNF superfamily member 2 Protein (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVS YETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTS YSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL |
Molecular Weight | 20 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |